.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x92

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of sedoheptulose-7-phosphate isomerase, a critical enzyme for lipopolysaccharide biosynthesis and a target for antibiotic adjuvants. J.Biol.Chem. 283 2835-2845 2008
    Site MCSG
    PDB Id 1x92 Target Id APC5045
    Related PDB Ids 3bjz 
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4655,AAG07813, 208964 Molecular Weight 21412.13 Da.
    Residues 197 Isoelectric Point 5.00
    Sequence mdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqhfssellnrf ererpslpavalttdsstitsiandysynevfskqiralgqpgdvllaistsgnsanviqaiqaahdre mlvvaltgrdgggmaslllpedveirvpskitariqevhllaihclcdlidrqlfgsee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.221
    Matthews' coefficent 3.01 Rfactor 0.176
    Waters 196 Solvent Content 59.17

    Ligand Information
    Ligands M7P (D-GLYCERO-D-MANNOPYRANOSE-7-PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1x92
    1. The interaction of DiaA and DnaA regulates the replication cycle in E. coli by directly promoting ATPDnaA-specific initiation complexes
    K Keyamura, N Fujikawa, T Ishida, S Ozaki - Genes & , 2007 - genesdev.cshlp.org
     
    2. Structure and function of sedoheptulose-7-phosphate isomerase, a critical enzyme for lipopolysaccharide biosynthesis and a target for antibiotic adjuvants
    PL Taylor, KM Blakely, GP de Leon, JR Walker - Journal of Biological , 2008 - ASBMB
     
    3. Structural similarity between the DnaA_binding proteins HobA (HP1230) from Helicobacter pylori and DiaA from Escherichia coli
    G Natrajan, DR Hall, AC Thompson - Molecular , 2007 - Wiley Online Library
     
    4. N-acetylmuramic acid 6-phosphate lyases (MurNAc etherases): role in cell wall metabolism, distribution, structure, and mechanism
    T Jaeger, C Mayer - Cellular and Molecular Life Sciences, 2008 - Springer
     
    5. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    6. The Structure of Sedoheptulose-7-Phosphate Isomerase from Burkholderia pseudomallei Reveals a Zinc Binding Site at the Heart of the Active Site
    NJ Harmer - Journal of molecular biology, 2010 - Elsevier
     
    7. Crystal structures of two putative phosphoheptose isomerases
    J Seetharaman, KR Rajashankar - Proteins: Structure, , 2006 - Wiley Online Library
     
    8. Crystal structure of YfeU protein from Haemophilus influenzae: a predicted etherase involved in peptidoglycan recycling
    Y Kim, P Quartey, R Ng, TI Zarembinski - Journal of structural and , 2009 - Springer
     
    9. Crystallographic and NMR Studies of Aquifex Aeolicus Phosphoheptose Isomerase: Structural Insights into the Mechanism of Aldose-Ketose Isomerization.
    V Thai, G Petsko, D Kern - The role of structure and dynamics in , 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1x92.png
    No description
    38.55 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch