.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x7v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The X-ray crystal structure of PA3566 from Pseudomonas aureginosa at 1.8 A resolution. Proteins 61 209-212 2005
    Site MCSG
    PDB Id 1x7v Target Id APC5058
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4668,AAG06954, 208964 Molecular Weight 11166.96 Da.
    Residues 97 Isoelectric Point 5.80
    Sequence mstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieqwrddaalerhq ntehflrfsrgneallqnvkidqlyrla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.78 Rfree 0.22297
    Matthews' coefficent 1.90 Rfactor 0.1641
    Waters 196 Solvent Content 35.10

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1x7v
    1. Haloferax volcanii PitA: an example of functional interaction between the Pfam chlorite dismutase and antibiotic biosynthesis monooxygenase families?
    E Bab-Dinitz, H Shmuely, J Maupin-Furlow - , 2006 - Oxford Univ Press
     
    2. Novel identification of expressed genes and functional classification of hypothetical proteins from Neisseria meningitidis serogroup A
    G Bernardini, S Arena, D Braconi, A Scaloni - , 2007 - Wiley Online Library
     
    3. A novel chimera: The truncated hemoglobin-antibiotic monooxygenase from Streptomyces avermitilis
    A Bonamore, A Attili, F Arenghi, B Catacchio - Gene, 2007 - Elsevier
     
    4. The crystal structure of Rv0793, a hypothetical monooxygenase from M._ tuberculosis
    MJ Lemieux, C Ference, MM Cherney, M Wang - Journal of structural and , 2005 - Springer
     
    5. Structural insight of the role of the Hahella chejuensis HapK protein in prodigiosin biosynthesis
    HJ Cho, KJ Kim, MH Kim - : Structure, Function, and , 2008 - Wiley Online Library
     
    6. Crystal structure and catalytic mechanism of 4-methylmuconolactone methylisomerase
    M Marn, DW Heinz, DH Pieper, BU Klink - Journal of Biological Chemistry, 2009 - ASBMB
     
    7. The X_ray crystal structure of PA3566 from Pseudomonas aureginosa at 1.8 resolution
    DAR Sanders, JR Walker, T Skarina - Proteins: Structure, , 2005 - Wiley Online Library
     
    8. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    9. 22 Protein X_Ray Crystallography
    DAR Sanders - Handbook of neurochemistry and molecular , 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch