.
The Open Protein Structure Annotation Network
PDB Keyword
.

1w8i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of Gene Product Af1683 from Archaeoglobus Fulgidus. To be Published
    Site MCSG
    PDB Id 1w8i Target Id APC5535
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4677,AAB89566, 224325 Molecular Weight 17839.55 Da.
    Residues 156 Isoelectric Point 5.61
    Sequence maalidtgiffgfyslkdvhhmdsvaivvhavegkwgrlfvtnhildetltllkykklpadkflegfve sgvlniiytddeverkalevfkarvyekgfsytdaisevvaeelklklisydsrfslptigrdywksld eserkrisailrekgidg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.225
    Matthews' coefficent 3.3 Rfactor 0.211
    Waters 142 Solvent Content 62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1w8i
    1. Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex
    F Glavan, I Behm-Ansmant, E Izaurralde, E Conti - The EMBO journal, 2006 - nature.com
     
    2. Crystal structure of PAE0151 from Pyrobaculum aerophilum, a PIN_domain (VapC) protein from a toxin_antitoxin operon
    RD Bunker, JL McKenzie, EN Baker - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. Interleukin_1_inducible MCPIP protein has structural and functional properties of RNase and participates in degradation of IL_1_ mRNA
    D Mizgalska, P W_grzyn, K Murzyn, A Kasza - FEBS , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch