.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uxo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Harvesting the High-Hanging Fruit: The Structure of the Yden Gene Product from Bacillus Subtilis at 1.8 A Resolution. Acta Crystallogr.,Sect.D 60 1101 2004
    Site MCSG
    PDB Id 1uxo Target Id APC1086
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4494,P96671, 1423 Molecular Weight 21720.71 Da.
    Residues 190 Isoelectric Point 6.18
    Sequence mtkqvyiihgyrasstnhwfpwlkkrlladgvqadilnmpnplqprledwldtlslyqhtlhentylva hslgcpailrflehlqlrkqlggiilvsgfakslptlqmldeftqgsfdhqkiiesakhraviaskddq ivpfsfskdlaqqidaalyevqhgghfledegftslpivydvltsyfsketr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.8 Rfree 0.181
    Matthews' coefficent 2.1 Rfactor 0.125
    Waters 290 Solvent Content 40.7

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1uxo
    1. Entropy and surface engineering in protein crystallization
    ZS Derewenda, PG Vekilov - Acta Crystallographica Section D: , 2005 - scripts.iucr.org
     
    2. Prediction of protein structure from ideal forms
    WR Taylor, GJ Bartlett, V Chelliah - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. Harvesting the high-hanging fruit: the structure of the YdeN gene product from Bacillus subtilis at 1.8 A resolution
    I Janda, Y Devedjiev, D Cooper, M Chruszcz - Section D: Biological , 2004 - scripts.iucr.org
     
    4. Towards the prediction of protein interaction partners using physical docking
    MN Wass, G Fuentes, C Pons, F Pazos - Molecular systems , 2011 - nature.com
     
    5. BuildBetaA system for automatically constructing beta sheets
    N Max, CC Hu, O Kreylos - : Structure, Function, and , 2010 - Wiley Online Library
     
    6. Functional site prediction selects correct protein models
    V Chelliah, WR Taylor - BMC bioinformatics, 2008 - biomedcentral.com
     
    7. Mass spectrometric identification of serine hydrolase OVCA2 in the medulloblastoma cell line DAOY
    AA Azizi, E Gelpi, JW Yang, B Rupp, AK Godwin - Cancer letters, 2006 - Elsevier
     
    8. Structure of XC6422 from Xanthomonas campestris at 1.6 A resolution: a small serine/-hydrolase
    CY Yang, KH Chin, CC Chou, AHJ Wang - Section F: Structural , 2006 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch