.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tp6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A crystal structure of a hypothetical protein PA1314 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1tp6 Target Id APC5545
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4684,AAG04703, 208964 Molecular Weight 14211.18 Da.
    Residues 128 Isoelectric Point 5.83
    Sequence mtcayrreihhahvairdwlagdsradaldalmarfaedfsmvtphgvvldktalgelfrskggtrpgl rieidgesllasgvdgatlayreiqsdaagrserlstvvlhrddegrlywrhlqetfcg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.226
    Matthews' coefficent 1.74 Rfactor 0.185
    Waters 143 Solvent Content 27.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tp6
    1. Quantum Chemical Investigations on Intraresidue Carbonyl_ Carbonyl Contacts in Aspartates of High-Resolution Protein Structures
    TK Pal, R Sankararamakrishnan - The Journal of Physical , 2009 - ACS Publications
     
    2. Beta_decomposition for the volume and area of the union of three_dimensional balls and their offsets
    DS Kim, J Ryu, H Shin, Y Cho - Journal of Computational , 2012 - Wiley Online Library
     
    3. Topologies of surfaces on molecules and their computation in O (n) time
    DS Kim, Y Cho, J Ryu, CM Kim - Computer-Aided Design, 2010 - Elsevier
     
    4. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     
    5. Protein Model Discrimination Using Mutational Sensitivity Derived from Deep Sequencing
    BV Adkar, A Tripathi, A Sahoo, K Bajaj, D Goswami - Structure, 2012 - Elsevier
     
    6. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    7. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch