.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tjn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of af0721: a hypothetical protein bearing sequence similarity with class II chelatases in cobalamin synthesis. To be Published
    Site MCSG
    PDB Id 1tjn Target Id APC5049
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4659,NP_069555, 224325 Molecular Weight 15108.65 Da.
    Residues 132 Isoelectric Point 6.11
    Sequence mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncdiiyvvplfi syglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailnsvfrigrdgkgee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.26006
    Matthews' coefficent 2.64 Rfactor 0.21725
    Waters 75 Solvent Content 0.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tjn
    1. Evolution of protein fold in the presence of functional constraints
    A Andreeva, AG Murzin - Current opinion in structural biology, 2006 - Elsevier
     
    2. Mechanical stretching of proteinsa theoretical survey of the Protein Data Bank
    JI Su_kowska, M Cieplak - Journal of Physics: Condensed Matter, 2007 - iopscience.iop.org
     
    3. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    4. Prediction of protein structure from ideal forms
    WR Taylor, GJ Bartlett, V Chelliah - Proteins: Structure, , 2008 - Wiley Online Library
     
    5. Crystal structure of the vitamin B 12 biosynthetic cobaltochelatase, CbiX S, from Archaeoglobus fulgidus
    J Yin, LX Xu, MM Cherney, E Raux-Deery - Journal of structural and , 2006 - Springer
     
    6. Probing the structural plasticity of an archaeal primordial cobaltochelatase CbiXS
    A Pisarchik, R Petri - Engineering Design and , 2007 - Oxford Univ Press
     
    7. Intra-chain 3D Segment Swapping Spawns the Evolution of New Multidomain Protein Architectures
    A Szilgyi, Y Zhang, P Zvodszky - Journal of Molecular Biology, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch