.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t9k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of aIF-2B translation initiation factor from Thermotoga maritima. To be Published
    Site MCSG
    PDB Id 1t9k Target Id APC4470
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4606,AAD35992, 2336 Molecular Weight 38047.90 Da.
    Residues 343 Isoelectric Point 5.98
    Sequence mklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafgyvlglrdyk tgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilenealkmayedievnkaigk ngaqlikdgstilthcnagalatvdygtalgviraavesgkrirvfadetrpylqgarltawelmkdgi evyvitdnmagwlmkrglidavvvgadrialngdtankigtyslavlakrnnipfyvaapvstidptir sgeeipieerrpeevthcggnriapegvkvlnpafdvtentlitaiitekgvirppfeenikkilev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.298
    Matthews' coefficent 2.66 Rfactor 0.239
    Waters 198 Solvent Content 52.98

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 1t9k
    1. STANDARD TRANSLATION INITIATION IN EUKARYOTES is the process that leads to assembly of an 80S ribosome on an mRNA in which the initiation codon is base
    TV Pestova, JR Lorsch - Translational control in , 2007 - books.google.com
     
    2. Translation initiation: structures, mechanisms and evolution
    A Marintchev, G Wagner - Quarterly reviews of biophysics, 2004 - Cambridge Univ Press
     
    3. Enzymatic characterization of 5-methylthioribose 1-phosphate isomerase from Bacillus subtilis
    Y Saito, H Ashida, C Kojima, H Tamura - Bioscience, , 2007 - J-STAGE
     
    4. Crystal structure of 5_methylthioribose 1_phosphate isomerase product complex from Bacillus subtilis: Implications for catalytic mechanism
    H Tamura, Y Saito, H Ashida, T Inoue, Y Kai - Protein , 2008 - Wiley Online Library
     
    5. Crystal Structure of the [alpha] Subunit of Human Translation Initiation Factor 2B
    TB Hiyama, T Ito, H Imataka, S Yokoyama - Journal of molecular biology, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch