.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t07

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PA5148 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1t07 Target Id APC5047
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4657,AAG08533, 208964 Molecular Weight 10624.49 Da.
    Residues 90 Isoelectric Point 6.09
    Sequence msrtvmcrkyheelpgldrppypgakgediynnvsrkawdewqkhqtmlinerrlnmmnaedrkflqqe mdkflsgedyakadgyvppsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.24
    Matthews' coefficent 2.14 Rfactor 0.192
    Waters 116 Solvent Content 49.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t07
    1. The solution structure of the oxidative stress_related protein YggX from Escherichia coli
    MJ Osborne, N Siddiqui, D Landgraf - Protein , 2005 - Wiley Online Library
     
    2. Solution structure of YggX: a prokaryotic protein involved in Fe (II) trafficking
    Q Cui, MP Thorgersen, WM Westler - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch