.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sfx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative HTH transcription regulator from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 1sfx Target Id APC5040
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS4651,AAB89246, 2234 Molecular Weight 12331.87 Da.
    Residues 106 Isoelectric Point 9.60
    Sequence msnplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllkrgfvrreive kgwvgyiysaekpekvlkefkssilgeieriekmftd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.18286
    Matthews' coefficent 2.38 Rfactor 0.14846
    Waters 398 Solvent Content 48.32

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 3
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 1sfx
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Real_value prediction of backbone torsion angles
    B Xue, O Dor, E Faraggi, Y Zhou - Proteins: Structure, Function, , 2008 - Wiley Online Library
     
    3. Solution Structure of Escherichia coli PapI, a Key Regulator of the Pap Pili Phase Variation
    T Kawamura, LUK Le, H Zhou, FW Dahlquist - Journal of molecular biology, 2007 - Elsevier
     
    4. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     
    5. Structural Differences between Proteins with Similar Sequences
    Q Cong, BH Kim, LN Kinch - (BIBE), 2010 IEEE , 2010 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch