.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s7h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.2A crystal structure of protein YKOF from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1s7h Target Id APC1273
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4523,O34911, 1423 Molecular Weight 22022.70 Da.
    Residues 200 Isoelectric Point 6.04
    Sequence mehicgtsriagfrfslypmtddfisviksalkktdtskvwtktdhistvlrgsidhvfdaakaiylha anseqhivmngtfsigcpgdtqgdtylskgdkrvnedavrglkaeapcqfalypmnepdymglimeavd iakaqgtfvqgvhyaseldgdahdvfstleavfrmaeqqtnhitmtvnlsanspsrknrkqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.281
    Matthews' coefficent 2.53 Rfactor 0.221
    Waters 372 Solvent Content 50.99

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1s7h
    1. The Structure and Ligand Binding Properties of the B. subtilis YkoF Gene Product, a Member of a Novel Family of Thiamin/HMP-binding Proteins
    Y Devedjiev, Y Surendranath, U Derewenda - Journal of molecular , 2004 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch