.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s5a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of APC1116 from Bacillus subtilis. TO BE PUBLISHED
    Site MCSG
    PDB Id 1s5a Target Id APC1116
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4497,O31511, 1423 Molecular Weight 17122.51 Da.
    Residues 147 Isoelectric Point 5.13
    Sequence mlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiydyikdypkqih lssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgrivryrdywnplvvkeafggs flqteesgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.236
    Matthews' coefficent 2.26 Rfactor 0.199
    Waters 540 Solvent Content 45.52

    Ligand Information
    Ligands ACT (ACETATE) x 4;GOL (GLYCEROL) x 6
    Metals

    Jmol

     
    Google Scholar output for 1s5a
    1. Integron-associated mobile gene cassettes code for folded proteins: the structure of Bal32a, a new member of the adaptable _+ _ barrel family
    A Robinson, PSC Wu, SJ Harrop, PM Schaeffer - Journal of molecular , 2005 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch