.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rz2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of sortase B from Staphylococcus aureus and Bacillus anthracis reveal catalytic amino acid triad in the active site. Structure 12 1147-1156 2004
    Site MCSG
    PDB Id 1rz2 Target Id APC2100
    Molecular Characteristics
    Source Bacillus anthracis stern
    Alias Ids TPS4584,AAP28474, 1392 Molecular Weight 30108.50 Da.
    Residues 254 Isoelectric Point 5.02
    Sequence mssekerkkkiffqriltvvflgtffysvyelgdifmdyyenrkvmaeaqniyekspmeeqsqdgevrk qfkalqqinqeivgwitmddtqinypivqakdndyylfrnykgedmragsifmdyrndvksqnrntily ghrmkdgsmfgslkkmldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsfle kiqekslyktdttvtagdqivtlstcdyaldpeagrlvvhaklvkrq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.266
    Matthews' coefficent 2.17 Rfactor 0.225
    Waters 187 Solvent Content 42.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rz2
    1. Structures of Sortase B from Staphylococcus aureus and Bacillus anthracis Reveal Catalytic Amino Acid Triad in the Active Site
    R Zhang, R Wu, G Joachimiak, SK Mazmanian - Structure, 2004 - Elsevier
     
    2. Benefits of structural genomics for drug discovery research
    M Grabowski, M Chruszcz, MD Zimmerman - disorders drug targets, 2009 - ncbi.nlm.nih.gov
     
    3. Crystal structure of Spy0129, a Streptococcus pyogenes class B sortase involved in pilus assembly
    HJ Kang, F Coulibaly, T Proft, EN Baker - PloS one, 2011 - dx.plos.org
     
    4. Molecular recognition and catalysis in sortase A from Staphylococcus aureus
    ML Bentley - 2009 - gradworks.umi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch