.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rxq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title YfiT from Bacillus subtilis Is a Probable Metal-Dependent Hydrolase with an Unusual Four-Helix Bundle Topology. Biochemistry 43 15472-15479 2004
    Site MCSG
    PDB Id 1rxq Target Id APC1142
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4503,O31562, 1423 Molecular Weight 20665.36 Da.
    Residues 178 Isoelectric Point 6.55
    Sequence mtsvnlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwtvrqvvhhla dshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelhgrwtallrtltdqqfkrg fyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.21708
    Matthews' coefficent 2.23 Rfactor 0.18644
    Waters 478 Solvent Content 44.88

    Ligand Information
    Ligands GLU-SER-ALA-THR-SER-GLY x 1
    Metals NI (NICKEL) x 4

    Jmol

     
    Google Scholar output for 1rxq
    1. An indel in transmembrane helix 2 helps to trace the molecular evolution of class A G-protein-coupled receptors
    J Devill, J Rey, M Chabbert - Journal of molecular evolution, 2009 - Springer
     
    2. YfiT from Bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology
    SS Rajan, X Yang, L Shuvalova, F Collart - Biochemistry, 2004 - ACS Publications
     
    3. The DinB Superfamily Includes Novel Mycothiol, Bacillithiol and Glutathione S-transferases
    GL Newton, SS Leung, JI Wakabayashi, M Rawat - Biochemistry, 2011 - ACS Publications
     
    4. The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily
    DR Cooper, K Grelewska, CY Kim - Section F: Structural , 2010 - scripts.iucr.org
     
    5. Crystal structure of TTHA0303 (TT2238), a four_helix bundle protein with an exposed histidine triad from Thermus thermophilus HB8 at 2.0
    K Nagata, J Ohtsuka, M Takahashi - Proteins: Structure, , 2008 - Wiley Online Library
     
    6. Novel l-Cysteine-Dependent Maleylpyruvate Isomerase in the Gentisate Pathway of Paenibacillus sp. Strain NyZ101
    TT Liu, NY Zhou - Journal of Bacteriology, 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch