.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rli

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure analysis of trp repressor binding protein from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1rli Target Id APC1769
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4558,P96726, 1423 Molecular Weight 20475.52 Da.
    Residues 181 Isoelectric Point 8.67
    Sequence mkiavinggtrsggntdvlaekavqgfdaehiylqkypiqpiedlrhaqggfrpvqddydsiierilqc hilifatpiywfgmsgtlklfidrwsqtlrdprfpdfkqqmsvkqayviavggdnpkikglpliqqfeh ifhfmgmsfkgyvlgegnrpgdilrdhqalsaasrllkrsdai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.23
    Matthews' coefficent 2.09 Rfactor 0.196
    Waters 529 Solvent Content 41.27

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3
    Metals PT (PLATINUM) x 11

    Jmol

     
    Google Scholar output for 1rli
    1. Mass fractal dimension and the compactness of proteins
    MB Enright, DM Leitner - Physical Review E, 2005 - APS
     
    2. Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH_dependent FMN reductase activity
    II Vorontsov, G Minasov, JS Brunzelle - Protein , 2007 - Wiley Online Library
     
    3. Interactions Between Proteins and Platinum-Containing Anti-Cancer Drugs
    C Bischin, A Lupan, V Taciuc - Mini Reviews in , 2011 - ingentaconnect.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch