.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rlh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a conserved protein from T. acidophilum. To be Published
    Site MCSG
    PDB Id 1rlh Target Id APC5510
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS4671,CAC12474, 2303 Molecular Weight 16923.47 Da.
    Residues 153 Isoelectric Point 6.31
    Sequence mvipaeaniivgyshfiktvedlneiirthvpgskygigfseasgdrlirydgndddlvkacienirri saghtfvilirnaypinilnavkmcqevgsifaatanplqiivykgergngvlgvidgyspvgvesdad iekrrqflrrigyke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.208
    Matthews' coefficent 2.12 Rfactor 0.179
    Waters 238 Solvent Content 41.98

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1rlh
    1. His-tag impact on structure
    M Carson, DH Johnson, H McDonald - Section D: Biological , 2007 - scripts.iucr.org
     
    2. FRankenstein becomes a cyborg: the automatic recombination and realignment of fold recognition models in CASP6
    J Kosinski, MJ Gajda, IA Cymerman - PROTEINS: , 2005 - Wiley Online Library
     
    3. The structure of an ancient conserved domain establishes a structural basis for stable histidine phosphorylation and identifies a new family of adenosine-specific
    JS Lott, B Paget, JM Johnston, LTJ Delbaere - Journal of Biological , 2006 - ASBMB
     
    4. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    5. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    6. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    7. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch