The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ywiB protein from Bacillus subtilis. to be published
    Site MCSG
    PDB Id 1r0u Target Id APC1791
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4562,O07624, 1423 Molecular Weight 16156.51 Da.
    Residues 142 Isoelectric Point 5.67
    Sequence mkqetpitlhvksvieddgnqeviefrttgfyyvkqnkvylsyyeehdlgkvktivkvsegevlvmrsg avkmnqrfvtgastiakykmsfgelelktstksiqsdldeekgrisiaydmhvgdeqehlhnmtityeg gtha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.2118
    Matthews' coefficent 2.75 Rfactor 0.1846
    Waters 196 Solvent Content 55.20

    Ligand Information
    Ligands GOL (GLYCEROL) x 1


    Google Scholar output for 1r0u

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch