.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q7h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a conserved hypothetical protein from T. acidophilum. TO BE PUBLISHED
    Site MCSG
    PDB Id 1q7h Target Id APC5505
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS4669,CAC12543, 2303 Molecular Weight 16761.43 Da.
    Residues 153 Isoelectric Point 7.93
    Sequence mtskhfiskkeakriweamarygiditgeslevaaqksasayyiggkpmvfqagdlipsvyllnyrnps rnivtvdegaephilngsdlfapgivsmddsirkgdmifvksskgyfiavgmaemdagevmatkrgkaa riihfpgdelirafp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.228
    Matthews' coefficent 2.28 Rfactor 0.169
    Waters 176 Solvent Content 46.10

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1q7h
    1. The Structure of the RNA m 5 C Methyltransferase YebU from Escherichia coli Reveals a C-terminal RNA-recruiting PUA Domain
    BM Hallberg, UB Ericsson, KA Johnson - Journal of molecular , 2006 - Elsevier
     
    2. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    3. Structural insights into the interaction of the Nip7 PUA domain with polyuridine RNA
    PP Coltri, BG Guimares, DC Granato, JS Luz - Biochemistry, 2007 - ACS Publications
     
    4. Crystal structure of hypothetical protein PH0734. 1 from hyperthermophilic archaea Pyrococcus horikoshii OT3
    K Miyazono, Y Nishimura, Y Sawano - Proteins: Structure, , 2008 - Wiley Online Library
     
    5. Studies on the inference of protein binding regions across fold space based on structural similarities
    J Teyra, J Hawkins, H Zhu - : Structure, Function, and , 2011 - Wiley Online Library
     
    6. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch