.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pw5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title putative nagD protein. To be Published
    Site MCSG
    PDB Id 1pw5 Target Id APC4903
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4630,AAD36807, 2336 Molecular Weight 28803.82 Da.
    Residues 259 Isoelectric Point 5.58
    Sequence mldkielfildmdgtfylddsllpgslefletlkeknkrfvfftnnsslgaqdyvrklrnmgvdvpdda vvtsgeitaehmlkrfgrcrifllgtpqlkkvfeayghvideenpdfvvlgfdktltyerlkkacillr kgkfyiathpdincpskegpvpdagsimaaieastgrkpdliagkpnplvvdvisekfgvpkermamvg drlytdvklgknagivsilvltgettpedleraetkpdfvfknlgelakavq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.279
    Matthews' coefficent Rfactor 0.244
    Waters 88 Solvent Content

    Ligand Information
    Ligands NDG (2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE) x 1;SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1pw5
    1. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    2. HAD superfamily phosphotransferase substrate diversification: structure and function analysis of HAD subclass IIB sugar phosphatase BT4131
    Z Lu, D Dunaway-Mariano, KN Allen - Biochemistry, 2005 - ACS Publications
     
    3. Structure and activity analyses of Escherichia coli K-12 NagD provide insight into the evolution of biochemical function in the haloalkanoic acid dehalogenase
    LW Tremblay, D Dunaway-Mariano, KN Allen - Biochemistry, 2006 - ACS Publications
     
    4. Crystal structure of trehalose_6_phosphate phosphataserelated protein: Biochemical and biological implications
    KN Rao, D Kumaran, J Seetharaman - Protein , 2006 - Wiley Online Library
     
    5. Activity-based functional annotation of unknown proteins: HAD-like hydrolases from E. coli and S. cerevisiae.
    E Kuznetsova - 2009 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch