.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pv5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Hypothetical Protein Ywqg from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1pv5 Target Id APC1771
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4559,P96719, 1423 Molecular Weight 30292.03 Da.
    Residues 261 Isoelectric Point 4.42
    Sequence mnhlpekmrpyrdlleksakeyvklnvrkgktgrydskiagdpyfpkhetyptdengqpmkllaqinfs hipqldgypssgilqfyisvhddvyglnfddrceqknfrviyfenivenddelvsdfsfigtgecdfpi lseaavepvkssewvlptdfqfeqytgmetmeffgqfgedeediynelaengfghkiggyasftqhdpr eyaykehtimllqidsdddidsmwgdvgianffitpedlrkkdfsnvlynwdcs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.235
    Matthews' coefficent 2.16 Rfactor 0.198
    Waters 360 Solvent Content 43.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pv5
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch