.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pbj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a hypothetical protein from M. thermautotrophicus reveals anovel fold and a pseudo 2-fold axis of symmetry. TO BE PUBLISHED
    Site MCSG
    PDB Id 1pbj Target Id APC5023
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS4639,AAB86095, 145262 Molecular Weight 13990.38 Da.
    Residues 125 Isoelectric Point 4.49
    Sequence mrvedvmvtdvdtiditasledvlrnyvenakgssvvvkegvrvgivttwdvleaiaegddlaevkvwe vmerdlvtispratikeaaekmvknvvwrllveeddeiigvisatdilrakmakry
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.202
    Matthews' coefficent 2.70 Rfactor 0.192
    Waters 297 Solvent Content 54.38

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1pbj
    1. Biochemical and Structural Characterization of a Novel Family of Cystathionine [beta]-Synthase Domain Proteins Fused to a Zn Ribbon-Like Domain
    M Proudfoot, SA Sanders, A Singer, R Zhang - Journal of molecular , 2008 - Elsevier
     
    2. CBS domains: structure, function, and pathology in human proteins
    S Ignoul, J Eggermont - American Journal of Physiology-Cell , 2005 - Am Physiological Soc
     
    3. NMR and X-ray crystallography, complementary tools in structural proteomics of small proteins
    AA Yee, A Savchenko, A Ignachenko - Journal of the , 2005 - ACS Publications
     
    4. Protein surface analysis for function annotation in high_throughput structural genomics pipeline
    TA Binkowski, A Joachimiak, J Liang - Protein science, 2005 - Wiley Online Library
     
    5. Structure of the Bateman2 domain of yeast Snf4: dimeric association and relevance for AMP binding
    MJ Rudolph, GA Amodeo, SH Iram, SP Hong, G Pirino - Structure, 2007 - Elsevier
     
    6. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    7. Mapping peptides correlated with transmission of intrasteric inhibition and allosteric activation in human cystathionine _-synthase
    S Sen, J Yu, M Yamanishi, D Schellhorn - Biochemistry, 2005 - ACS Publications
     
    8. Structures and functional implications of an AMP-binding cystathionine _-synthase domain protein from a hyperthermophilic archaeon
    NP King, TM Lee, MR Sawaya, D Cascio - Journal of molecular , 2008 - Elsevier
     
    9. The CBS Domain Protein MJ0729 of Methanocaldococcus jannaschii Is a Thermostable Protein with a pH-Dependent Self-Oligomerization
    LA Marti_nez-Cruz, JA Encinar, D Kortazar, J Prieto - Biochemistry, 2009 - ACS Publications
     
    10. Predicting and characterizing protein functions through matching geometric and evolutionary patterns of binding surfaces
    J Liang, YY Tseng, J Dundas, TA Binkowski - Advances in protein , 2008 - Elsevier
     
    11. Structural motif screening reveals a novel, conserved carbohydrate-binding surface in the pathogenesis-related protein PR-5d
    AC Doxey, Z Cheng, BA Moffatt - BMC structural , 2010 - biomedcentral.com
     
    12. The CBS Domain: A Protein Module with an Emerging Prominent Role in Regulation
    AA Baykov, HK Tuominen, R Lahti - ACS Chemical Biology, 2011 - ACS Publications
     
    13. Purification, crystallization and preliminary crystallographic analysis of the CBS-domain protein MJ1004 from Methanocaldococcus jannaschii
    I Oyenarte, M Lucas, I Gomez Garcia - Section F: Structural , 2011 - scripts.iucr.org
     
    14. Disulde bonds, 7172 Drug discovery, proteins negative image construction, 133134 pharmacophore information, 135136
    A Cell - Structural Genomics, 2008 - books.google.com
     
    15. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     
    16. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     
    17. Structural Basis of Allosteric and Intrasteric Regulation in Human Cystathionine _-Synthase and its Regulation by a CXXC Motif
    S Sen - 2007 - digitalcommons.unl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch