.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p99

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The membrane-associated lipoprotein-9 GmpC from Staphylococcus aureus binds the dipeptide GlyMet via side chain interactions. Biochemistry 43 16193-16202 2004
    Site MCSG
    PDB Id 1p99 Target Id APC009
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS4411,BAB41652, 1280 Molecular Weight 30484.44 Da.
    Residues 280 Isoelectric Point 9.02
    Sequence mkrliglvivalvllaacgsnndkkvtigvasndtkawekvkelakkddidveikhfsdynlpnkalnd gdidmnafqhfafldqykkahkgtkisalsttvlaplgiysdkikdvkkvkdgakvvipndvsnqaral klleaagliklkkdfglagtvkditsnpkhlkitavdaqqtaralsdvdiavinngvatkagkdpkndp ifleksnsdavkpyinivavndkdldnktyakivelyhskeaqkalqedvkdgekpvnlskdeikaiet slak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.236
    Matthews' coefficent 2.12 Rfactor 0.2
    Waters 292 Solvent Content 42.02

    Ligand Information
    Ligands GLY-MET x 1
    Metals

    Jmol

     
    Google Scholar output for 1p99
    1. A structural classification of substrate-binding proteins
    RPA Berntsson, SHJ Smits, L Schmitt, DJ Slotboom - FEBS letters, 2010 - Elsevier
     
    2. The membrane-associated lipoprotein-9 GmpC from Staphylococcus aureus binds the dipeptide GlyMet via side chain interactions
    WA Williams, R Zhang, M Zhou, G Joachimiak - Biochemistry, 2004 - ACS Publications
     
    3. Crystal structure of lipoprotein GNA1946 from Neisseria meningitidis
    X Yang, Z Wu, X Wang, C Yang, H Xu - Journal of structural biology, 2009 - Elsevier
     
    4. Crystal structure of toll_like receptor 2_activating lipoprotein IIpA from Vibrio vulnificus
    S Yu, NY Lee, SJ Park, S Rhee - Proteins: Structure, Function, , 2011 - Wiley Online Library
     
    5. Cloning, overexpression, purification, crystallization, and preliminary X-ray studies of SP_0149, the substrate binding protein of an ABC transporter from Streptococcus
    J Bhushan, R Vyas, T Sharma, D Sehgal - Section F: Structural , 2011 - scripts.iucr.org
     
    6. A structural classification of substrate-binding proteins
    PAB Ronnie, SHJ Smits, L Schmitt, DJ Slotboom - FEBS , 2010 - gbb.eldoc.ub.rug.nl
     
    7. New protein structure prediction method using inter-residue distances and a theoretical investigation of the isomerization of azobenzene and disubstituted
    CR Crecca - 2008 - ufdcimages.uflib.ufl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch