.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oru

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of APC1665, YUAD protein from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1oru Target Id APC1665
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4552,O32079, 1423 Molecular Weight 21301.50 Da.
    Residues 192 Isoelectric Point 8.31
    Sequence mwkrmtakaeglyiadtksfvtkqmdkldfdyggipgdlhfgltkkagarepmfsrgteifnrrqisiv sieecneialkmgvprilpewlganvavsgmpdltslkegsriifpsgaallcegendpciqpgeviqs yypdqpklasafvrhalgirgivciverpgavytgdeievhsyqrkvkrkaerv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.225
    Matthews' coefficent 2.45 Rfactor 0.196
    Waters 365 Solvent Content 49.43

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 1oru
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     
    3. Search for identical octapeptides in unrelated proteins: Structural plasticity revisited
    KM Saravanan, S Selvaraj - Peptide Science, 2012 - Wiley Online Library
     
    4. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch