.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Bacillus subtilis Hypothetical Protein APC1120. To be Published
    Site MCSG
    PDB Id 1oq1 Target Id APC1120
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4498,O31524, 1423 Molecular Weight 25201.39 Da.
    Residues 220 Isoelectric Point 7.73
    Sequence mykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfpdgiivtwdfspi eqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyfrrkyaeerafrtcnlrksrgf hlaamgadplpspddadspyrmklikdkgyvhfsinglpilewmddgstygpvltkgkigfrqmapmka vyrdfavhqavrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.208
    Matthews' coefficent 2.00 Rfactor 0.182
    Waters 999 Solvent Content 38.00

    Ligand Information
    Ligands ACY (ACETIC) x 4;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1oq1
    1. Structural and functional insights into the B30. 2/SPRY domain
    JS Woo, JH Imm, CK Min, KJ Kim, SS Cha, BH Oh - The EMBO journal, 2006 - nature.com
     
    2. Human thrombospondin's (TSP-1) C-terminal domain opens to interact with the CD-47 receptor: a molecular modeling study
    N Floquet, S Dedieu, L Martiny, M Dauchez - Archives of biochemistry , 2008 - Elsevier
     
    3. X-ray crystallographic native sulfur SAD structure determination of laminarinase Lam16A from Phanerochaete chrysosporium
    J Vasur, R Kawai, AM Larsson, K Igarashi - Section D: Biological , 2006 - scripts.iucr.org
     
    4. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch