.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nrw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a HALOACID DEHALOGENASE-LIKE HYDROLASE FROM B. SUBTILIS. To be Published
    Site MCSG
    PDB Id 1nrw Target Id APC1773
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4560,P94592, 1423 Molecular Weight 31953.15 Da.
    Residues 285 Isoelectric Point 5.05
    Sequence mkliaidldgtllnskhqvslenenalrqaqrdgievvvstgrahfdvmsifeplgiktwvisangavi hdpegrlyhhetidkkraydilswlesenyyyevftgsaiytpqngrelldveldrfrsanpeadlsvl kqaaevqysqsgfayinsfqelfeadepidfynilgfsffkekleagwkryehaedltlvssaehnfel ssrkaskgqalkrlakqlnipleetaavgdslndksmleaagkgvamgnarediksiadavtltndehg vahmmkhll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.222
    Matthews' coefficent 2.20 Rfactor 0.194
    Waters 489 Solvent Content 43.68

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 1nrw
    1. Evolutionary genomics of the HAD superfamily: understanding the structural adaptations and catalytic diversity in a superfamily of phosphoesterases and allied
    AM Burroughs, KN Allen, D Dunaway-Mariano - Journal of molecular , 2006 - Elsevier
     
    2. HAD superfamily phosphotransferase substrate diversification: structure and function analysis of HAD subclass IIB sugar phosphatase BT4131
    Z Lu, D Dunaway-Mariano, KN Allen - Biochemistry, 2005 - ACS Publications
     
    3. Analysis of the substrate specificity loop of the HAD superfamily cap domain
    SD Lahiri, G Zhang, J Dai, D Dunaway-Mariano - Biochemistry, 2004 - ACS Publications
     
    4. X-ray crystal structure of the hypothetical phosphotyrosine phosphatase MDP-1 of the haloacid dehalogenase superfamily
    E Peisach, JD Selengut, D Dunaway-Mariano - Biochemistry, 2004 - ACS Publications
     
    5. Investigation of metal ion binding in phosphonoacetaldehyde hydrolase identifies sequence markers for metal-activated enzymes of the HAD enzyme superfamily
    G Zhang, MC Morais, J Dai, W Zhang - Biochemistry, 2004 - ACS Publications
     
    6. Crystal structure of trehalose_6_phosphate phosphataserelated protein: Biochemical and biological implications
    KN Rao, D Kumaran, J Seetharaman - Protein , 2006 - Wiley Online Library
     
    7. STATISTICAL SCALING LAWS REFLECTING STRUCTURAL PROPERTIES OF THE HYDROLASES
    D CRACIUN, A ISVORAN, NM AVRAM - Paper presented at the National , 2008 - nipne.ro
     
    8. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     
    9. Three-dimensional motifs as signatures of protein function and evolution
    BJ Polacco - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch