.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nri

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical protein HI0754 from Haemophilus influenzae. To be Published
    Site MCSG
    PDB Id 1nri Target Id APC446
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS4472,P44862, 727 Molecular Weight 32529.90 Da.
    Residues 303 Isoelectric Point 5.77
    Sequence mndiilkslstliteqrnpnsvdidrqstleivrlmneedklvplaiesclpqislaveqivqafqqgg rliyigagtsgrlgvldasecpptfgvstemvkgiiaggecairhpvegaedntkavlndlqsihfskn dvlvgiaasgrtpyviaglqyakslgaltisiasnpksemaeiadiaietivgpeiltgssrlksgtaq kmvlnmlttasmillgkcyenlmvdvqasneklkaravrivmqatdcnktlaeqtlleadqnaklaimm ilstlskseakvllerhqgklrnalsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.246
    Matthews' coefficent 2.09 Rfactor 0.2116
    Waters 196 Solvent Content 41.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nri
    1. Finding functional sites in structural genomics proteins
    A Stark, A Shkumatov, RB Russell - Structure, 2004 - Elsevier
     
    2. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    3. N-acetylmuramic acid 6-phosphate lyases (MurNAc etherases): role in cell wall metabolism, distribution, structure, and mechanism
    T Jaeger, C Mayer - Cellular and Molecular Life Sciences, 2008 - Springer
     
    4. Mechanistic Studies on N-Acetylmuramic Acid 6-Phosphate Hydrolase (MurQ): An Etherase Involved in Peptidoglycan Recycling
    T Hadi, U Dahl, C Mayer, ME Tanner - Biochemistry, 2008 - ACS Publications
     
    5. Crystal structures of two putative phosphoheptose isomerases
    J Seetharaman, KR Rajashankar - Proteins: Structure, , 2006 - Wiley Online Library
     
    6. Crystal structure of YfeU protein from Haemophilus influenzae: a predicted etherase involved in peptidoglycan recycling
    Y Kim, P Quartey, R Ng, TI Zarembinski - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch