.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nn4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.2 A resolution structure of RpiB/AlsB from Escherichia coli illustrates a new approach to the ribose-5-phosphate isomerase reaction. J.Mol.Biol. 332 1083-1094 2003
    Site MCSG
    PDB Id 1nn4 Target Id APC072
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4437,AAC77051, 562 Molecular Weight 16072.49 Da.
    Residues 149 Isoelectric Point 6.58
    Sequence mkkiafgcdhvgfilkheivahlvergvevidkgtwssertdyphyasqvalavaggevdggilicgtg vgisiaankfagiravvcsepysaqlsrqhndtnvlafgsrvvglelakmivdawlgaqyeggrhqqrv eaitaieqrrn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.262
    Matthews' coefficent 2.83 Rfactor 0.216
    Waters 298 Solvent Content 56.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nn4
    1. Protein surface analysis for function annotation in high_throughput structural genomics pipeline
    TA Binkowski, A Joachimiak, J Liang - Protein science, 2005 - Wiley Online Library
     
    2. Finding functional sites in structural genomics proteins
    A Stark, A Shkumatov, RB Russell - Structure, 2004 - Elsevier
     
    3. The 2.2 Resolution Structure of RpiB/AlsB from Escherichia coli Illustrates a New Approach to the Ribose-5-phosphate Isomerase Reaction
    RG Zhang, CE Andersson, T Skarina - Journal of molecular , 2003 - Elsevier
     
    4. Mycobacterium tuberculosis Ribose-5-phosphate Isomerase has a Known Fold, but a Novel Active Site
    AK Roos, CE Andersson, T Bergfors - Journal of molecular , 2004 - Elsevier
     
    5. Crystal structure of a ribose_5_phosphate isomerase RpiB (TM1080) from Thermotoga maritima at 1.90 resolution
    Q Xu, R Schwarzenbacher, D McMullan - Proteins: Structure, , 2004 - Wiley Online Library
     
    6. D-ribose-5-phosphate isomerase B from Escherichia coli is also a functional D-allose-6-phosphate isomerase, while the Mycobacterium tuberculosis enzyme is not
    AK Roos, S Mariano, E Kowalinski, L Salmon - Journal of molecular , 2008 - Elsevier
     
    7. Predicting and characterizing protein functions through matching geometric and evolutionary patterns of binding surfaces
    J Liang, YY Tseng, J Dundas, TA Binkowski - Advances in protein , 2008 - Elsevier
     
    8. Substrate specificity of ribose-5-phosphate isomerases from Clostridium difficile and Thermotoga maritima
    SJ Yeom, BN Kim, CS Park, DK Oh - Biotechnology letters, 2010 - Springer
     
    9. Crystal structure of Clostridium thermocellum ribose-5-phosphate isomerase B reveals properties critical for fast enzyme kinetics
    J Jung, JK Kim, SJ Yeom, YJ Ahn, DK Oh - Applied microbiology and , 2011 - Springer
     
    10. Structures of type B ribose 5_phosphate isomerase from Trypanosoma cruzi shed light on the determinants of sugar specificity in the structural family
    AL Stern, A Naworyta, JJ Cazzulo, SL Mowbray - FEBS Journal, 2011 - Wiley Online Library
     
    11. Structural and Functional Studies of Ribose-5-phosphate isomerase B
    AK Roos - 2007 - uu.diva-portal.org
     
    12. Sequence-based enzyme catalytic domain prediction using clustering and aggregated mutual information content
    K Choi, S Kim - , Imaging and Systems Biology (HISB), 2011 , 2011 - ieeexplore.ieee.org
     
    13. For Review Only
    A Naworyta, T de Chascoms, S Mowbray - FEBS Journal, 2011 - uu.diva-portal.org
     
    14. Structural characterization of a ribose-5-phosphate isomerase B from the pathogenic fungus Coccidioides immitis
    TE Edwards, AB Abramov, ER Smith - BMC structural , 2011 - biomedcentral.com
     
    15. Structure-Based Virtual Screening
    M JACOBSSON - 2008 - uu.diva-portal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch