.
The Open Protein Structure Annotation Network
PDB Keyword
.

1njk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Escherichia coli Hypothetical Protein YbaW. To be Published
    Site MCSG
    PDB Id 1njk Target Id APC3503
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4591,NP_414977, 562 Molecular Weight 15087.56 Da.
    Residues 132 Isoelectric Point 5.31
    Sequence mqtqikvrgyhldvyqhvnnarylefleearwdglensdsfqwmtahniafvvvnininyrrpavlsdl ltitsqlqqlngksgilsqvitlepegqvvadalitfvcidlktqkalalegelrekleqmvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.24
    Matthews' coefficent 2.71 Rfactor 0.214
    Waters 355 Solvent Content 54.68

    Ligand Information
    Ligands
    Metals IOD (IODIDE) x 4

    Jmol

     
    Google Scholar output for 1njk
    1. The Hotdog fold: wrapping up a superfamily of thioesterases and dehydratases
    S Dillon, A Bateman - BMC bioinformatics, 2004 - biomedcentral.com
     
    2. A structural model of the plant acyl-acyl carrier protein thioesterase FatB comprises two helix/4-stranded sheet domains, the N-terminal domain containing residues
    KM Mayer, J Shanklin - Journal of Biological Chemistry, 2005 - ASBMB
     
    3. Divergence of Function in the Hot Dog Fold Enzyme Superfamily: The Bacterial Thioesterase YciA
    Z Zhuang, F Song, H Zhao, L Li, J Cao, E Eisenstein - Biochemistry, 2008 - ACS Publications
     
    4. Rv0216, a conserved hypothetical protein from Mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdog fold
    A Castell, P Johansson, T Unge, TA Jones - Protein , 2005 - Wiley Online Library
     
    5. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     
    6. Preferential Hydrolysis of Aberrant Intermediates by the Type II Thioesterase in Escherichia coli Nonribosomal Enterobactin Synthesis: Substrate Specificities and
    ZF Guo, Y Sun, S Zheng, Z Guo - Biochemistry, 2009 - ACS Publications
     
    7. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    8. Identification and Characterization of Escherichia coli Thioesterase III That Functions in Fatty Acid _-Oxidation
    L Nie, Y Ren, H Schulz - Biochemistry, 2008 - ACS Publications
     
    9. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    10. Structure and function of a Campylobacter jejuni thioesterase Cj0915, a hexameric hot dog fold enzyme
    T Yokoyama, KJ Choi, AM Bosch, HJ Yeo - Biochimica et Biophysica Acta ( , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch