.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ni9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and Biochemical Characterization of the Type II Fructose-1,6-bisphosphatase GlpX from Escherichia coli. J.Biol.Chem. 284 3784-3792 2009
    Site MCSG
    PDB Id 1ni9 Target Id APC5007
    Related PDB Ids 3d1r 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4634,P28860, 562 Molecular Weight 35850.27 Da.
    Residues 336 Isoelectric Point 5.32
    Sequence mrrelaiefsrvtesaalagykwlgrgdkntadgaavnamrimlnqvnidgtivigegeideapmlyig ekvgtgrgdavdiavdpiegtrmtamgqanalavlavgdkgcflnapdmymeklivgpgakgtidlnlp ladnlrnvaaalgkplseltvtilakprhdaviaemqqlgvrvfaipdgdvaasiltcmpdsevdvlyg iggapegvvsaaviraldgdmngrllarhdvkgdneenrrigeqelarckamgieagkvlrlgdmarsd nvifsatgitkgdllegisrkgniattetllirgksrtirriqsihyldrkdpemqvhil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2436
    Matthews' coefficent 2.25 Rfactor 0.18656
    Waters 143 Solvent Content 45.23

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1ni9
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Structural and biochemical characterization of the type II fructose-1, 6-bisphosphatase GlpX from Escherichia coli
    G Brown, A Singer, VV Lunin, M Proudfoot - Journal of Biological , 2009 - ASBMB
     
    3. The PDB
    D Fischer, J Pa_, L Rychlewski - Bioinformatics, 2004 - Oxford Univ Press
     
    4. Patch prediction of protein interaction sites: validation of a scoring function for an online server
    S Jones, Y Mukarami - Bioinformatics Research and Development, 2007 - Springer
     
    5. Crystallization and preliminary X-ray characterization of the glpX-encoded class II fructose-1, 6-bisphosphatase from Mycobacterium tuberculosis
    HJ Gutka, SG Franzblau, F Movahedzadeh - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch