.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ng6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.4A crystal structure of hypothetical cytosolic protein YQEY. To be Published
    Site MCSG
    PDB Id 1ng6 Target Id APC1524
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4543,P54464, 1423 Molecular Weight 16765.55 Da.
    Residues 148 Isoelectric Point 5.71
    Sequence msllerlnqdmklymknrekdkltvvrmvkaslqneaiklkkdsltedeeltvlsrelkqrkdslqefs nanrldlvdkvqkeldilevylpeqlseeelrtivnetiaevgasskadmgkvmgaimpkvkgkadgsl inklvssqls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.247
    Matthews' coefficent 2.10 Rfactor 0.21
    Waters 295 Solvent Content 41.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ng6
    1. ProFunc: a server for predicting protein function from 3D structure
    RA Laskowski, JD Watson - Nucleic Acids Research, 2005 - Oxford Univ Press
     
    2. Ammonia channel couples glutaminase with transamidase reactions in GatCAB
    A Nakamura, M Yao, S Chimnaronk, N Sakai, I Tanaka - Science, 2006 - sciencemag.org
     
    3. Structural basis of RNA-dependent recruitment of glutamine to the genetic code
    H Oshikane, K Sheppard, S Fukai, Y Nakamura - Science, 2006 - sciencemag.org
     
    4. Identification of the ligand binding sites on the molecular surface of proteins
    K Kinoshita, H Nakamura - Protein Science, 2005 - Wiley Online Library
     
    5. Structural basis for tRNA-dependent amidotransferase function
    E Schmitt, M Panvert, S Blanquet, Y Mechulam - Structure, 2005 - Elsevier
     
    6. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    7. Deinococcus glutaminyl-tRNA synthetase is a chimer between proteins from an ancient and the modern pathways of aminoacyl-tRNA formation
    M Deniziak, C Sauter, HD Becker - Nucleic acids , 2007 - Oxford Univ Press
     
    8. Computing van der Waals energies in the context of the rotamer approximation
    G Grigoryan, A Ochoa - : Structure, Function, and , 2007 - Wiley Online Library
     
    9. Combining specificity determining and conserved residues improves functional site prediction
    O Kalinina, M Gelfand, R Russell - BMC bioinformatics, 2009 - biomedcentral.com
     
    10. Two distinct regions in Staphylococcus aureus GatCAB guarantee accurate tRNA recognition
    A Nakamura, K Sheppard, J Yamane, M Yao - Nucleic acids , 2010 - Oxford Univ Press
     
    11. Analysis of chameleon sequences by energy decomposition on a pairwise per-residue basis
    S Yoon, H Jung - The protein journal, 2006 - Springer
     
    12. Comparing protein contact maps via Universal Similarity Metric: an improvement in the noise-tolerance
    S Rahmati, JI Glasgow - journal of computational biology and drug , 2009 - Inderscience
     
    13. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    14. Cpl-7, a lysozyme encoded by a pneumococcal bacteriophage with a novel cell wall-binding motif
    N Bustamante, NE Campillo, E Garca - Journal of Biological , 2010 - ASBMB
     
    15. Disorder Can Exist inside Well-Diffracting Crystals
    E Touz, B Lorber, M Deniziak, HD Becker - Crystal Growth and , 2007 - ACS Publications
     
    16. Description and recognition of regular and distorted secondary structures in proteins using the automated protein structure analysis method
    S Ranganathan, D Izotov, E Kraka - Structure, Function, and , 2009 - Wiley Online Library
     
    17. Amino-acid-dependent main-chain torsion-energy terms for protein systems
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1206.3909, 2012 - arxiv.org
     
    18. IMPROVED EFFICIENCY IN CRYO-EM SECONDARY STRUCTURE TOPOLOGY DETERMINATION FROM INACCURATE DATA
    A BISWAS, SI DONG, K AL NASR - of Bioinformatics and , 2012 - World Scientific
     
    19. Side-chain rotamers in protein _-_ hairpins and a mechanism of their selection
    AM Kargatov, AV Efimov - Molecular Biology, 2007 - Springer
     
    20. A Constraint Dynamic Graph Approach to Identify the Secondary Structure Topology from cryoEM Density Data in Presence of Errors
    A Biswas, D Si, KA Nasr, D Ranjan - (BIBM), 2011 IEEE , 2011 - ieeexplore.ieee.org
     
    21. Optimizations of protein force fields
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1208.6150, 2012 - arxiv.org
     
    22. The Universal Similarity Metric, applied to contact maps comparison in a two-dimensional space
    S Rahmati - 2008 - catspaw.its.queensu.ca
     
    23. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     
    24. Computational approaches for the design and prediction of protein-protein interactions
    AE Keating, G Grigoryan - 2007 - dspace.mit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch