The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Thermotoga maritima 0065, a member of the IclR transcriptional factor family. J.Biol.Chem. 277 19183-19190 2002
    Site MCSG
    PDB Id 1mkm Target Id APC048
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4427,AAD35159, 2336 Molecular Weight 28117.25 Da.
    Residues 246 Isoelectric Point 8.65
    Sequence mntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryvpgyklieygs fvlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipmvsrlgmkvdlystasgks ilafvpekelkeylkivelkpktpntitnprvlkrelekirkrgyavdneeneigimcvgvpifdhngy pvagvsisgvarkfteekieeysdvlkekaeeisrklgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.3
    Matthews' coefficent 2.78 Rfactor 0.232
    Waters 111 Solvent Content 55.71

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals ZN (ZINC) x 2


    Google Scholar output for 1mkm
    1. Members of the IclR family of bacterial transcriptional regulators function as activators and/or repressors
    AJ Molina_Henares, T Krell - FEMS microbiology , 2006 - Wiley Online Library
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
    3. Using structural motif templates to identify proteins with DNA binding function
    S Jones, JA Barker, I Nobeli - Nucleic acids research, 2003 - Oxford Univ Press
    4. Glyoxylate and pyruvate are antagonistic effectors of the Escherichia coli IclR transcriptional regulator
    GL Lorca, A Ezersky, VV Lunin, JR Walker - Journal of Biological , 2007 - ASBMB
    5. The IclR family of transcriptional activators and repressors can be defined by a single profile
    T Krell, AJ Molina_Henares, JL Ramos - Protein science, 2006 - Wiley Online Library
    6. Structural and biochemical study of effector molecule recognition by the E. coli glyoxylate and allantoin utilization regulatory protein AllR
    JR Walker, S Altamentova, A Ezersky, G Lorca - Journal of molecular , 2006 - Elsevier
    7. Different Modes of Binding of Mono-and Biaromatic Effectors to the Transcriptional Regulator TTGV
    ME Guazzaroni, MT Gallegos, JL Ramos - Journal of Biological , 2007 - ASBMB
    8. TtgV represses two different promoters by recognizing different sequences
    S Fillet, M Vlez, D Lu, X Zhang - Journal of , 2009 - Am Soc Microbiol
    9. Crystal structure of SpoVT, the final modulator of gene expression during spore development in Bacillus subtilis
    I Asen, S Djuranovic, AN Lupas, K Zeth - Journal of molecular biology, 2009 - Elsevier
    10. Biochemical characterization of the RNase II family of exoribonucleases from the human pathogens Salmonella typhimurium and Streptococcus pneumoniae
    S Domingues, RG Matos, FP Reis, AM Fialho - Biochemistry, 2009 - ACS Publications
    11. Crystal structure of TtgV in complex with its DNA operator reveals a general model for cooperative DNA binding of tetrameric gene regulators
    D Lu, S Fillet, C Meng, Y Alguel - Genes & , 2010 - genesdev.cshlp.org
    12. Discriminative random field approach to prediction of protein residue contacts
    M Kamada, M Hayashida, J Song - Systems Biology (ISB), , 2011 - ieeexplore.ieee.org
    13. Crystal structure of the PH1932 protein, a unique archaeal ArsR type winged_HTH transcription factor from Pyrococcus horikoshii OT3
    H Itou, M Yao, N Watanabe - : Structure, Function, and , 2008 - Wiley Online Library
    14. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
    15. The structure of SpoVT
    I Asen - 2008 - edoc.ub.uni-muenchen.de
    16. Structure of an MmyB-Like Regulator from C. aurantiacus, Member of a New Transcription Factor Family Linked to Antibiotic Metabolism in Actinomycetes
    Q Xu, GP van Wezel, HJ Chiu, L Jaroszewski, HE Klock - PloS one, 2012 - dx.plos.org
    17. Structural and functional characterization of IclR transcription regulators
    A Ezersky - 2009 -
    18. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    No description
    30.59 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch