.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mk4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.7A crystal structure of a hypothetical protein yqjY from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1mk4 Target Id APC1490
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4541,P54562, 1423 Molecular Weight 17851.46 Da.
    Residues 156 Isoelectric Point 7.80
    Sequence mdirtitssdyemvtsvlnewwggrqlkeklprlffehfqdtsfitsehnsmtgfligfqsqsdpetay ihfsgvhpdfrkmqigkqlydvfietvkqrgctrvkcvtspvnkvsiayhtklgfdiekgtktvngisv fanydgpgqdrvlfvkni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.228
    Matthews' coefficent 3.10 Rfactor 0.22
    Waters 325 Solvent Content 60.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1mk4
    1. Comparative modeling in CASP5: progress is evident, but alignment errors remain a significant hindrance
    _ Venclovas - Proteins: Structure, Function, and Bioinformatics, 2003 - Wiley Online Library
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. A less laborious approach to the high-throughput production of recombinant proteins in Escherichia coli using 2-liter plastic bottles
    C Sanville Millard, L Stols, P Quartey, Y Kim - Protein expression and , 2003 - Elsevier
     
    4. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    5. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    6. A structural pattern_based method for protein fold recognition
    WR Taylor, I Jonassen - PROTEINS: Structure, Function, and , 2004 - Wiley Online Library
     
    7. Sampling of near_native protein conformations during protein structure refinement using a coarse_grained model, normal modes, and molecular dynamics simulations
    AW Stumpff_Kane, K Maksimiak - Proteins: Structure, , 2008 - Wiley Online Library
     
    8. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    9. Aromatic-Aromatic Interactions Database, A2ID: An Analysis of Aromatic [pi]-Networks in Proteins
    M Chourasia, GM Sastry, GN Sastry - International Journal of Biological , 2011 - Elsevier
     
    10. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    11. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    12. Conformational Sampling in Structure Prediction and Refinement with Atomistic and Coarse-Grained Models
    M Feig, SM Gopal, K Vadivel - Multiscale Approaches to , 2011 - Springer
     
    13. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch