.
The Open Protein Structure Annotation Network
PDB Keyword
.

1m6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal complexes of a predicted S-adenosylmethionine-dependent methyltransferase reveal a typical AdoMet binding domain and a substrate recognition domain. Protein Sci. 12 1432-1442 2003
    Site MCSG
    PDB Id 1m6y Target Id APC038
    Related PDB Ids 1n2x 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4418,AAD35954, 2336 Molecular Weight 34891.33 Da.
    Residues 299 Isoelectric Point 7.70
    Sequence mrkysqrhipvmvrevieflkpedekiildctvgegghsrailehcpgcriigidvdsevlriaeeklk efsdrvslfkvsyreadfllktlgiekvdgilmdlgvstyqlkgenrgftfereepldmrmdlesevta qkvlnelpeeelariifeygeekrfarriarkivenrplnttldlvkavrealpsyeirrrkrhfatkt fqairiyvnrelenlkeflkkaedllnpggrivvisfhsledrivketfrnskklriltekpvrpseee irenprarsgrlraaerieeggd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.212
    Matthews' coefficent 2.79 Rfactor 0.197
    Waters 367 Solvent Content 55.98

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 2;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1m6y
    1. Many paths to methyltransfer: a chronicle of convergence
    HL Schubert, RM Blumenthal, X Cheng - Trends in biochemical sciences, 2003 - Elsevier
     
    2. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
     
    3. Predictions without templates: new folds, secondary structure, and contacts in CASP5
    P Aloy, A Stark, C Hadley - : Structure, Function, and , 2003 - Wiley Online Library
     
    4. Crystal complexes of a predicted S_adenosylmethionine_dependent methyltransferase reveal a typical AdoMet binding domain and a substrate recognition domain
    DJ Miller, N Ouellette, E Evdokimova - Protein , 2003 - Wiley Online Library
     
    5. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    6. A structural pattern_based method for protein fold recognition
    WR Taylor, I Jonassen - PROTEINS: Structure, Function, and , 2004 - Wiley Online Library
     
    7. A novel and efficient tool for locating and characterizing protein cavities and binding sites
    A Tripathi, GE Kellogg - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    8. Assessing the reliability of sequence similarities detected through hydrophobic cluster analysis
    PJ Silva - Proteins: Structure, Function, and Bioinformatics, 2008 - Wiley Online Library
     
    9. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    10. Comprehensive analysis of the helix_X_helix motif in soluble proteins
    J Deville, J Rey, M Chabbert - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    11. Structure of catalytically competent intein caught in a redox trap with functional and evolutionary implications
    BP Callahan, NI Topilina, MJ Stanger - Nature structural & , 2011 - nature.com
     
    12. Disulfide conformation and design at helix N_termini
    S Indu, ST Kumar, S Thakurela, M Gupta - Proteins: Structure, , 2010 - Wiley Online Library
     
    13. 1 Protein methyltransferases: Their distribution among the five structural classes of adomet-dependent methyltransferases
    HL Schubert, RM Blumenthal, X Cheng - The Enzymes, 2006 - Elsevier
     
    14. Crystal and solution structures of methyltransferase RsmH provide basis for methylation of C1402 in 16S rRNA
    Y Wei, H Zhang, ZQ Gao, WJ Wang - Journal of Structural , 2012 - Elsevier
     
    15. Etude structurale des cassures d'hlices et son application la modlisation des rcepteurs coupls aux protines G (RCPG)
    J Devill - 2007 - hal.archives-ouvertes.fr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch