.
The Open Protein Structure Annotation Network
PDB Keyword
.

1m3s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Bacillus subtilis YckF: structural and functional evolution. J.Struct.Biol. 148 98-109 2004
    Site MCSG
    PDB Id 1m3s Target Id APC1056
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4489,P42404, 1423 Molecular Weight 19961.80 Da.
    Residues 185 Isoelectric Point 5.82
    Sequence mktteyvaeilnelhnsaayisneeadqladhilsshqiftagagrsglmaksfamrlmhmgfnahivg eiltpplaegdlviigsgsgetkslihtaakakslhgivaaltinpessigkqadliirmpgspkdqsn gsyktiqpmgslfeqtlllfydavilklmekkgldsetmfthhanle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.22493
    Matthews' coefficent 2.30 Rfactor 0.18708
    Waters 205 Solvent Content 46.45

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1m3s
    1. The many faces of the helix_turn_helix domain: Transcription regulation and beyond_
    L Aravind, V Anantharaman, S Balaji - FEMS microbiology , 2005 - Wiley Online Library
     
    2. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
     
    3. Prediction of protein loop conformations using the AGBNP implicit solvent model and torsion angle sampling
    AK Felts, E Gallicchio, D Chekmarev - Journal of chemical , 2008 - ACS Publications
     
    4. Toward better refinement of comparative models: predicting loops in inexact environments
    BD Sellers, K Zhu, S Zhao, RA Friesner - Proteins: Structure, , 2008 - Wiley Online Library
     
    5. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    6. Sampling of near_native protein conformations during protein structure refinement using a coarse_grained model, normal modes, and molecular dynamics simulations
    AW Stumpff_Kane, K Maksimiak - Proteins: Structure, , 2008 - Wiley Online Library
     
    7. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    8. A seqlet-based maximum entropy Markov approach for protein secondary structure prediction
    Q Dong, X Wang, L Lin, Y Guan - Science in China Series C: Life Sciences, 2005 - Springer
     
    9. Crystal structure of Bacillus subtilis YckF: structural and functional evolution
    R Sanishvili, R Wu, DE Kim, JD Watson - Journal of structural , 2004 - Elsevier
     
    10. Structure prediction and functional analysis of KdsD, an enzyme involved in lipopolysaccharide biosynthesis
    S Sommaruga, LD Gioia, P Tortora, A Polissi - Biochemical and biophysical , 2009 - Elsevier
     
    11. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    12. Conformational Sampling in Structure Prediction and Refinement with Atomistic and Coarse-Grained Models
    M Feig, SM Gopal, K Vadivel - Multiscale Approaches to , 2011 - Springer
     
    13. Crystal structure of YfeU protein from Haemophilus influenzae: a predicted etherase involved in peptidoglycan recycling
    Y Kim, P Quartey, R Ng, TI Zarembinski - Journal of structural and , 2009 - Springer
     
    14. Crystal structure of 3_hexulose_6_phosphate synthase, a member of the orotidine 5__monophosphate decarboxylase suprafamily
    I Orita, A Kita, H Yurimoto, N Kato - Proteins: Structure, , 2010 - Wiley Online Library
     
    15. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    16. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch