.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l6r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure- and function-based characterization of a new phosphoglycolate phosphatase from Thermoplasma acidophilum. J.Biol.Chem. 279 517-526 2004
    Site MCSG
    PDB Id 1l6r Target Id APC014
    Related PDB Ids 1kyt 
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS4415,CAC11321, 2303 Molecular Weight 25277.37 Da.
    Residues 224 Isoelectric Point 5.03
    Sequence mirlaaidvdgtltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgingpvfgenggi mfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpedvdyvrkeaesrgfvifys gyswhlmnrgedkafavnklkemysleydeilvigdsnndmpmfqlpvrkacpanatdnikavsdfvsd ysygeeigqifkhfelm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.195
    Matthews' coefficent 2.43 Rfactor 0.171
    Waters 715 Solvent Content 49.42

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals CA (CALCIUM) x 5

    Jmol

     
    Google Scholar output for 1l6r
    1. Caught in the act: The structure of phosphorylated _-phosphoglucomutase from Lactococcus lactis
    SD Lahiri, G Zhang, D Dunaway-Mariano, KN Allen - Biochemistry, 2002 - ACS Publications
     
    2. Evolutionary genomics of the HAD superfamily: understanding the structural adaptations and catalytic diversity in a superfamily of phosphoesterases and allied
    AM Burroughs, KN Allen, D Dunaway-Mariano - Journal of molecular , 2006 - Elsevier
     
    3. HAD superfamily phosphotransferase substrate diversification: structure and function analysis of HAD subclass IIB sugar phosphatase BT4131
    Z Lu, D Dunaway-Mariano, KN Allen - Biochemistry, 2005 - ACS Publications
     
    4. Analysis of the substrate specificity loop of the HAD superfamily cap domain
    SD Lahiri, G Zhang, J Dai, D Dunaway-Mariano - Biochemistry, 2004 - ACS Publications
     
    5. X-ray crystal structure of the hypothetical phosphotyrosine phosphatase MDP-1 of the haloacid dehalogenase superfamily
    E Peisach, JD Selengut, D Dunaway-Mariano - Biochemistry, 2004 - ACS Publications
     
    6. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    7. Structure and activity analyses of Escherichia coli K-12 NagD provide insight into the evolution of biochemical function in the haloalkanoic acid dehalogenase
    LW Tremblay, D Dunaway-Mariano, KN Allen - Biochemistry, 2006 - ACS Publications
     
    8. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    9. Investigation of metal ion binding in phosphonoacetaldehyde hydrolase identifies sequence markers for metal-activated enzymes of the HAD enzyme superfamily
    G Zhang, MC Morais, J Dai, W Zhang - Biochemistry, 2004 - ACS Publications
     
    10. Kinetic evidence for a substrate-induced fit in phosphonoacetaldehyde hydrolase catalysis
    G Zhang, AS Mazurkie, D Dunaway-Mariano - Biochemistry, 2002 - ACS Publications
     
    11. Crystal structure of trehalose_6_phosphate phosphataserelated protein: Biochemical and biological implications
    KN Rao, D Kumaran, J Seetharaman - Protein , 2006 - Wiley Online Library
     
    12. The thrH gene product of Pseudomonas aeruginosa is a dual activity enzyme with a novel phosphoserine: homoserine phosphotransferase activity
    SK Singh, K Yang, S Karthikeyan, T Huynh - Journal of Biological , 2004 - ASBMB
     
    13. Patch prediction of protein interaction sites: validation of a scoring function for an online server
    S Jones, Y Mukarami - Bioinformatics Research and Development, 2007 - Springer
     
    14. Using correlated parameters for improved ranking of proteinprotein docking decoys
    P Mitra, D Pal - Journal of computational chemistry, 2011 - Wiley Online Library
     
    15. A Method to Find Sequentially Separated Motifs in Biological Sequences (SSMBS)
    C Kumar, N Kumar, S Rangarajan - Pattern Recognition in , 2008 - Springer
     
    16. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    17. Structure of a haloacid dehalogenase superfamily phosphatase PH1421 from Pyrococcus horikoshii OT3: oligomeric state and thermoadaptation mechanism
    H Yamamoto, K Takio, M Sugahara - Section D: Biological , 2008 - scripts.iucr.org
     
    18. Overexpression, purification, characterization and preliminary crystallographic study of phosphoglycolate phosphatase from Shigella flexneri 2a strain 301
    H Liu, H Zhou, D Zhu, R Bi - Acta Crystallographica Section F: , 2008 - scripts.iucr.org
     
    19. Dynamic features of homo_dimer interfaces calculated by normal mode analysis
    Y Tsuchiya, K Kinoshita, S Endo, H Wako - Protein Science, 2012 - Wiley Online Library
     
    20. Estudos estruturais da enzima fosforribosilpirofosfato sintase de cana-de-acar
    HB Napolitano - 2004 - ifsc.usp.br
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1kyt.png
    No description
    33.11 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch