The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of SAICAR synthase from Thermotoga maritima at 2.2 angstroms reveals an unusual covalent dimer. Acta Crystallogr.,Sect.F 62 335-339 2006
    Site MCSG
    PDB Id 1kut Target Id APC043
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4422,AAD36318, 2336 Molecular Weight 26229.14 Da.
    Residues 230 Isoelectric Point 6.47
    Sequence mnyegktkivkvtgdyallefkdditagdglkhdvltgkgsicaettailmkylsekgikthlveyipp rtlkviplkmfplevvvrlkkagsfvrryggaegedlpvplveffikdderhdpmvcvdhleilgiatk kqaekmkeaavkitlalkefferanfelwdikyefgldkdgnvvlgdeispdtfrlrkkgeifdkdvyr rdlgdplkkyrevlelcrslnsq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.281
    Matthews' coefficent 2.07 Rfactor 0.245
    Waters 81 Solvent Content 40.49

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1kut
    1. Nucleotide complexes of Escherichia coli phosphoribosylaminoimidazole succinocarboxamide synthetase
    ND Ginder, DJ Binkowski, HJ Fromm - Journal of Biological , 2006 - ASBMB
    2. Octameric structure of the human bifunctional enzyme PAICS in purine biosynthesis
    SX Li, YP Tong, XC Xie, QH Wang, HN Zhou - Journal of molecular , 2007 - Elsevier
    3. Structure of SAICAR synthase from Thermotoga maritima at 2.2 A reveals an unusual covalent dimer
    R Zhang, T Skarina, E Evdokimova - Section F: Structural , 2006 - scripts.iucr.org
    4. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of SAICAR synthase from Streptococcus suis serotype 2
    X Cheng, G Lu, J Qi, H Cheng, F Gao - Section F: Structural , 2010 - scripts.iucr.org
    5. Flaviviridae Mutants Comprising a Deletion in the Capsid Protein for Use as Vaccines
    FX Heinz, C Mandl, P Schlick - US Patent App. 12/866,631, 2009 - Google Patents

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch