.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ktn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.5A crystal structure of 2-deoxyribose-5-phosphate aldlase. To be Published
    Site MCSG
    PDB Id 1ktn Target Id APC077
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4440,AAC77334, 562 Molecular Weight 27732.15 Da.
    Residues 259 Isoelectric Point 5.50
    Sequence mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktlkeqgtpeir iatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfdlvkackeacaaanvllkv iietgelkdealirkaseisikagadfiktstgkvavnatpesarimmevirdmgvektvgfkpaggvr taedaqkylaiadelfgadwadarhyrfgassllasllkalghgdgksassy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.2050000
    Matthews' coefficent 2.38 Rfactor 0.1860000
    Waters 631 Solvent Content 48.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ktn
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. A simple approach for protein structure discrimination based on the network pattern of conserved hydrophobic residues
    UK Muppirala, Z Li - Protein Engineering Design and Selection, 2006 - Oxford Univ Press
     
    3. Analysis of the class I aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase at 0.99 resolution
    A Heine, JG Luz, CH Wong, IA Wilson - Journal of molecular biology, 2004 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch