.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kr4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of CutA from Thermotoga maritima at 1.4 A resolution. Proteins 54 162-165 2004
    Site MCSG
    PDB Id 1kr4 Target Id APC012
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4413,AAD36133, 2336 Molecular Weight 12176.50 Da.
    Residues 101 Isoelectric Point 5.30
    Sequence milvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifktteekekelyeel rklhpyetpaiftlkvenvlteymnwlresvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.241
    Matthews' coefficent Rfactor 0.218
    Waters 125 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1kr4
    1. From protein structure to biochemical function?
    RA Laskowski, JD Watson, JM Thornton - Journal of structural and , 2003 - Springer
     
    2. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
     
    3. Prediction of side_chain conformations on protein surfaces
    Z Xiang, PJ Steinbach, MP Jacobson - PROTEINS: , 2007 - Wiley Online Library
     
    4. X_ray crystal structure of CutA from Thermotoga maritima at 1.4 resolution
    A Savchenko, T Skarina, E Evdokimova - Proteins: Structure, , 2004 - Wiley Online Library
     
    5. Structure of putative CutA1 from Homo sapiens determined at 2.05 A resolution
    B Bagautdinov, Y Matsuura, S Bagautdinova - Section F: Structural , 2008 - scripts.iucr.org
     
    6. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    7. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    8. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch