.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kjn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MT0777. To be published
    Site MCSG
    PDB Id 1kjn Target Id APC078
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS4441,H69203, 145262 Molecular Weight 17273.85 Da.
    Residues 157 Isoelectric Point 4.58
    Sequence mktestgkalmvlgcpespvqiplaiytshklkkkgfrvtvtanpaalrlvqvadpegiytdemvdles cinelaegdyeflagfvpndaaaaylvtfagilntetlaiifdrdadvleelvneimetldaeiiaara hhnpaplrvridrfmeekp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.25
    Matthews' coefficent 2.32 Rfactor 0.217
    Waters 173 Solvent Content 46.93

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1kjn
    1. From protein structure to biochemical function?
    RA Laskowski, JD Watson, JM Thornton - Journal of structural and , 2003 - Springer
     
    2. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    3. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    5. Prediction of protein structure from ideal forms
    WR Taylor, GJ Bartlett, V Chelliah - Proteins: Structure, , 2008 - Wiley Online Library
     
    6. BuildBetaA system for automatically constructing beta sheets
    N Max, CC Hu, O Kreylos - : Structure, Function, and , 2010 - Wiley Online Library
     
    7. Functional site prediction selects correct protein models
    V Chelliah, WR Taylor - BMC bioinformatics, 2008 - biomedcentral.com
     
    8. Letter to the Editor: Complete 1 H, 13 C and 15 N NMR assignments of MTH0776 from Methanobacterium thermoautotrophicum
    G Amegbey, Z Chang, P Stothard, A Yee - Journal of Biomolecular , 2004 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch