.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k4n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved protein YecM from Escherichia coli shows structural homology to metal-binding isomerases and oxygenases. Proteins 51 311-314 2003
    Site MCSG
    PDB Id 1k4n Target Id APC070
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4436,NP_754182, 562 Molecular Weight 21465.19 Da.
    Residues 190 Isoelectric Point 5.22
    Sequence mimanwqsidelqdiasdlprfthaldelsrrlglditpltadhislrchqnvtaerwrrgfeqcgell senmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehieivlpgdpetlnaralallsde glslpgisvktsspkgeherlpnptlavtdgkttikfhpwsieeivaseqsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.217
    Matthews' coefficent 1.96 Rfactor 0.199
    Waters 253 Solvent Content 37.18

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1k4n
    1. Protein surface analysis for function annotation in high_throughput structural genomics pipeline
    TA Binkowski, A Joachimiak, J Liang - Protein science, 2005 - Wiley Online Library
     
    2. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    3. Prediction of side_chain conformations on protein surfaces
    Z Xiang, PJ Steinbach, MP Jacobson - PROTEINS: , 2007 - Wiley Online Library
     
    4. Predicting and characterizing protein functions through matching geometric and evolutionary patterns of binding surfaces
    J Liang, YY Tseng, J Dundas, TA Binkowski - Advances in protein , 2008 - Elsevier
     
    5. How does a topological inversion change the evolutionary constraints on membrane proteins?
    H Ichihara, H Daiyasu, H Toh - Protein Engineering Design and , 2004 - Oxford Univ Press
     
    6. Conserved protein YecM from Escherichia coli shows structural homology to metal_binding isomerases and oxygenases
    RG Zhang, N Duke, R Laskowski - Proteins: Structure, , 2003 - Wiley Online Library
     
    7. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    8. Identification of two-histidines one-carboxylate binding motifs in proteins amenable to facial coordination to metals
    B Amrein, M Schmid, G Collet, P Cuniasse, F Gilardoni - Metallomics, 2012 - xlink.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch