The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Analysis of the Thermotoga maritima IclR Transcriptional Regulator. To be Published
    Site MCSG
    PDB Id 1jmr Target Id APC048
    Related PDB Ids 1mkm 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4426,AAD35159, 2336, Molecular Weight 28117.25 Da.
    Residues 246 Isoelectric Point 8.65
    Sequence mntlkkafeildfivknpgdvsvseiaekfnmsvsnaykymvvleekgfvlrkkdkryvpgyklieygsf vlrrfnirdiahdhlvdimkrtgetvhlilkdgfegvyidkvegeqsipmvsrlgmkvdlystasgksi lafvpekelkeylkivelkpktpntitnprvlkrelekirkrgyavdneeneigimcvgvpifdhngyp vagvsisgvarkfteekieeysdvlkekaeeisrklgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.3000000
    Matthews' coefficent 2.78 Rfactor 0.2320000
    Waters 111 Solvent Content 55.72

    Ligand Information
    Ligands CO2 (CARBON) x 1
    Metals ZN (ZINC) x 2


    Google Scholar output for 1jmr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch