.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j8r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of the interaction of the pyelonephritic E. coli adhesin to its human kidney receptor. Cell(Cambridge,Mass.) 105 733-743 2001
    Site MCSG
    PDB Id 1j8r Target Id APC3005
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4587,AAA24296, 562 Molecular Weight 37664.88 Da.
    Residues 336 Isoelectric Point 8.65
    Sequence mkkwfpallfslcvsgessawnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpef adgfwayyreyiawvvfpkkvmtqngyplfievhnkgswseentgdndsyfflkgykwderafdagnlc qkpgeitrltekfddiifkvalpadlplgdysvkipytsgmqrhfasylgarfkipynvaktlprenem lflfkniggcrpsaqsleikhgdlsinsannhyaaqtlsvscdvpanirfmllrnttptyshgkkfsvg lghgwdsivsvngvdtgettmrwykagtqnltigsrlygesskiqpgvlsgsatllmilp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.242
    Matthews' coefficent 3.81 Rfactor 0.22
    Waters 182 Solvent Content 67.68

    Ligand Information
    Ligands NGA-GLA-GAL-BGC (N-ACETYL-D-GALACTOSAMINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1j8r
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    3. The fimbrial adhesin F17_G of enterotoxigenic Escherichia coli has an immunoglobulin_like lectin domain that binds N_acetylglucosamine
    L Buts, J Bouckaert, E De Genst, R Loris - Molecular , 2003 - Wiley Online Library
     
    4. A tale of two pili: assembly and function of pili in bacteria
    KA Kline, KW Dodson, MG Caparon, SJ Hultgren - Trends in microbiology, 2010 - Elsevier
     
    5. Molecular structure of adhesin domains in Escherichia coli fimbriae
    B Westerlund-Wikstrm, TK Korhonen - International journal of medical , 2005 - Elsevier
     
    6. A receptor-binding site as revealed by the crystal structure of CfaE, the colonization factor antigen I fimbrial adhesin of enterotoxigenic Escherichia coli
    YF Li, S Poole, F Rasulova, AL McVeigh - Journal of Biological , 2007 - ASBMB
     
    7. Combining sites of bacterial fimbriae
    H De Greve, L Wyns, J Bouckaert - Current opinion in structural biology, 2007 - Elsevier
     
    8. Structural Biology of Bacterial Secretion Systems in Gram-Negative Pathogens-Potential for New Drug Targets
    E Durand, D Verger, AT Rgo - Infectious Disorders , 2009 - benthamscience.com
     
    9. Adhesive organelles of Gram_negative pathogens assembled with the classical chaperone/usher machinery: structure and function from a clinical standpoint
    V Zav'yalov, A Zavialov, G Zav'yalova - FEMS microbiology , 2010 - Wiley Online Library
     
    10. Mechanical strength of 17 134 model proteins and cysteine slipknots
    M Sikora, JI Su_kowska, M Cieplak - PLoS computational biology, 2009 - dx.plos.org
     
    11. Carbohydrate Mediated Bacterial Adhesion
    RJ Pieters - Bacterial Adhesion, 2011 - Springer
     
    12. Surface organelles assembled by secretion systems of Gram_negative bacteria: diversity in structure and function
    DG Thanassi, JB Bliska - FEMS Microbiology , 2012 - Wiley Online Library
     
    13. Mechanisms of Bacterial Adhesion and Consequences of Attachment
    GG Anderson, YM Lee, CL Smith - Molecular Paradigms of , 2006 - Springer
     
    14. La lectine PA-IIL de Pseudomonas aeruginosa: Structure, affinit et spcificit pour des ligands naturels et glycomimtiques
    M Wimmerova - 2007 - hal.inria.fr
     
    15. Molecular Assembly in Natural and Engineered Systems
    S Howorka - 2011 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch