.
The Open Protein Structure Annotation Network
PDB Keyword
.

1inl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor. Nat.Struct.Biol. 9 27-31 2002
    Site MCSG
    PDB Id 1inl Target Id APC047
    Related PDB Ids 1jq3 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4424,AAD35738, 2336 Molecular Weight 34140.37 Da.
    Residues 296 Isoelectric Point 5.30
    Sequence mrtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfaldgitmtt ekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailcevdglvieaarkylkqts cgfddpraeiviangaeyvrkfknefdviiidstdptagqgghlfteefyqacydalkedgvfsaeted pfydigwfklayrriskvfpitrvylgfmttypsgmwsytfaskgidpikdfdpekvrkfnkelkyyne evhvasfalpnfvkkelglm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.213
    Matthews' coefficent 2.47 Rfactor 0.199
    Waters 867 Solvent Content 50.26

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1inl
    1. SAM (dependent) I AM: the S-adenosylmethionine-dependent methyltransferase fold
    JL Martin, FM McMillan - Current opinion in structural biology, 2002 - Elsevier
     
    2. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
     
    3. 3D-QSAR study for DNA cleavage proteins with a potential anti-tumor ATCUN-like motif
    H Gonzlez-Daz, Snchez-Gonzlez - Journal of inorganic , 2006 - Elsevier
     
    4. Conformational selection in silico: loop latching motions and ligand binding in enzymes
    S Wong, MP Jacobson - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    5. Structural and mechanistic insights into the action of Plasmodium falciparum spermidine synthase
    PB Burger, LM Birkholtz, F Joubert, N Haider - Bioorganic & medicinal , 2007 - Elsevier
     
    6. Cloning, expression, characterisation and three-dimensional structure determination of Caenorhabditis elegans spermidine synthase
    VT Dufe, K Lersen, ML Eschbach, N Haider - FEBS letters, 2005 - Elsevier
     
    7. ATCUN_like metal_binding motifs in proteins: Identification and characterization by crystal structure and sequence analysis
    R Sankararamakrishnan, S Verma - Structure, Function, and , 2005 - Wiley Online Library
     
    8. Mammalian Spermidine SynthaseIdentification of Cysteine Residues and Investigation of the Putrescine Binding Site
    H Goda, T Watanabe, N Takeda, M Kobayashi - Biological and , 2004 - J-STAGE
     
    9. Crystal Structures and Enzymatic Properties of a Triamine/Agmatine Aminopropyltransferase from Thermus thermophilus
    M Ohnuma, T Ganbe, Y Terui, M Niitsu, T Sato - Journal of Molecular , 2011 - Elsevier
     
    10. The crystal structure of Escherichia coli spermidine synthase SpeE reveals a unique substrate-binding pocket
    X Zhou, TK Chua, KL Tkaczuk, JM Bujnicki - Journal of structural , 2010 - Elsevier
     
    11. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    12. Conformational Sampling of Flexible Ligand-binding Protein Loops
    GR Lee, WH Shin, H Park, S Shin - Bull. Korean Chem. , 2012 - newjournal.kcsnet.or.kr
     
    13. Estudos estruturais da enzima fosforribosilpirofosfato sintase de cana-de-acar
    HB Napolitano - 2004 - ifsc.usp.br
     
    14. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch