The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Thermotoga maritima stationary phase survival protein SurE: a novel acid phosphatase. Structure 9 1095-1106 2001
    Site MCSG
    PDB Id 1ilv Target Id APC175
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4461,AAD36729, 2336 Molecular Weight 28073.59 Da.
    Residues 247 Isoelectric Point 4.99
    Sequence mrilvtnddgiqskgiivlaellseehevfvvapdkersatghsitihvplwmkkvfiservvaysttg tpadcvklaynvvmdkrvdlivsgvnrgpnmgmdilhsgtvsgamegammnipsiaissanyespdfeg aarflidflkefdfslldpftmlninvpageikgwrftrqsrrrwndyfeervspfgekyywmmgevie dddrddvdykavregyvsitpihpfltneqclkklrevyd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.258
    Matthews' coefficent 2.65 Rfactor 0.244
    Waters 252 Solvent Content 53.53

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1ilv
    1. Structure of Thermotoga maritima Stationary Phase Survival Protein SurE:: A Novel Acid Phosphatase
    RG Zhang, T Skarina, JE Katz, S Beasley - Structure, 2001 - Elsevier
    2. Structure and Function of an Archaeal Homolog of Survival Protein E (SurE [alpha]): An Acid Phosphatase with Purine Nucleotide Specificity
    C Mura, JE Katz, SG Clarke, D Eisenberg - Journal of molecular biology, 2003 - Elsevier
    3. Crystal structure of the stationary phase survival protein SurE with metal ion and AMP
    W Iwasaki, K Miki - Journal of molecular biology, 2007 - Elsevier
    4. Structure of SurE protein from Aquifex aeolicus VF5 at 1.5 A resolution
    SV Antonyuk, MJ Ellis, RW Strange - Section F: Structural , 2009 - scripts.iucr.org
    VN GLADYSHEV - Redox biochemistry, 2008 - books.google.com

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch