.
The Open Protein Structure Annotation Network
PDB Keyword
.

1i60

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Bacillus subtilis ioli shows endonuclase IV fold with altered Zn binding. Proteins 48 423-426 2002
    Site MCSG
    PDB Id 1i60 Target Id APC236
    Related PDB Ids 1i6n 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4465,P42419, 1423 Molecular Weight 31654.38 Da.
    Residues 278 Isoelectric Point 4.85
    Sequence mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhikplalnalv ffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikkssvdvltelsdiaepygvk ialefvghpqctvntfeqayeivntvnrdnvglvldsfhfhamgsnieslkqadgkkifiyhiddtedf pigfltdedrvwpgqgaidldahlsalkeigfsdvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.2275
    Matthews' coefficent 2.95 Rfactor 0.2142
    Waters 182 Solvent Content 58.25

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1i60
    1. Comparative modeling in CASP6 using consensus approach to template selection, sequence_structure alignment, and structure assessment
    _ Venclovas, M Margelevi_ius - Proteins: Structure, Function, , 2005 - Wiley Online Library
     
    2. Topology and Sequence in the Folding of a TIM Barrel Protein: Global Analysis Highlights Partitioning between Transient Off-pathway and Stable On-pathway Folding
    WR Forsyth, O Bilsel, Z Gu, CR Matthews - Journal of molecular biology, 2007 - Elsevier
     
    3. Hydropathy analysis to correlate structure and function of proteins
    L Damodharan, V Pattabhi - Biochemical and biophysical research , 2004 - Elsevier
     
    4. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    5. What lessons can be learned from studying the folding of homologous proteins?
    AA Nickson, J Clarke - Methods, 2010 - Elsevier
     
    6. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    7. Structure of L-xylulose-5-Phosphate 3-epimerase (UlaE) from the anaerobic L-ascorbate utilization pathway of Escherichia coli: identification of a novel phosphate
    R Shi, M Pineda, E Ajamian, Q Cui, A Matte - Journal of , 2008 - Am Soc Microbiol
     
    8. Crystal Structure of SCO6571 from Streptomyces coelicolor A3 (2)
    P Begum, N Sakai, T Hayashi, YG Gao - Protein and peptide , 2008 - ingentaconnect.com
     
    9. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    10. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch