.
The Open Protein Structure Annotation Network
PDB Keyword
.

1hru

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of the yrdC gene product from Escherichia coli reveals a new fold and suggests a role in RNA binding. Protein Sci. 9 2557-2566 2000
    Site MCSG
    PDB Id 1hru Target Id APC117
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4451,P45748, 562 Molecular Weight 20766.58 Da.
    Residues 190 Isoelectric Point 4.94
    Sequence mnnnlqrdaiaaaidvlneerviaypteavfgvgcdpdsetavmrllelkqrpvdkgliliaanyeqlk pyiddtmltdvqretifsrwpgpvtfvfpapattprwltgrfdslavrvtdhplvvalcqaygkplvst sanlsglppcrtvdevraqfgaafpvvpgetggrlnpseirdaltgelfrqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2140000
    Matthews' coefficent 2.82 Rfactor 0.2020000
    Waters 386 Solvent Content 56.31

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1hru
    1. The structure of the yrdC gene product from Escherichia coli reveals a new fold and suggests a role in RNA binding
    M Teplova, V Tereshko, R Sanishvili - Protein , 2000 - Cambridge Univ Press
     
    2. Analysis of and function predictions for previously conserved hypothetical or putative proteins in Blochmannia floridanus
    P Gaudermann, I Vogl, E Zientz, FJ Silva - Bmc , 2006 - biomedcentral.com
     
    3. Active site identification through geometry-based and sequence profile-based calculations: burial of catalytic clefts
    R Greaves, J Warwicker - Journal of molecular biology, 2005 - Elsevier
     
    4. Sua5p a single-stranded telomeric DNA-binding protein facilitates telomere replication
    FL Meng, Y Hu, N Shen, XJ Tong, J Wang, J Ding - The EMBO , 2009 - nature.com
     
    5. Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites
    S Petkun, R Shi, Y Li, A Asinas, C Munger, L Zhang - Structure, 2011 - Elsevier
     
    6. Structure-based functional inference of hypothetical proteins from Mycoplasma hyopneumoniae
    MM Da Fonsca, A Zaha, ER Caffarena - Journal of Molecular , 2011 - Springer
     
    7. Novel CO2 Regulated Proteins in Synechocystis PCC 6803
    D Carmel - 2011 - doria17-kk.lib.helsinki.fi
     
    8. The structure of the hypothetical protein smu. 1377c from Streptococcus mutans suggests a role in tRNA modification
    TM Fu, X Liu, L Li, XD Su - Acta Crystallographica Section F: , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch