.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g60

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MboIIA methyltransferase. Nucleic Acids Res. 31 5440-5448 2003
    Site MCSG
    PDB Id 1g60 Target Id APC128
    Molecular Characteristics
    Source Mycobacterium bovis
    Alias Ids TPS4456,P23192, 1765 Molecular Weight 30075.77 Da.
    Residues 260 Isoelectric Point 8.64
    Sequence mleinkihqmncfdfldqvenksvqlavidppynlskadwdsfdshneflpftyrwidkvldkldkdgs lyifntpfncaficqylvskgmifqnwitwdkrdgmgsakrgfstgqetilffsksknhtfnydevrvp yestdrikhasekgilkngkrwfpnpngrlcgevwhfssqrhkekvngktvklthitpkprdlieriir assnpndlvldcfmgsgttaivakklgrnfigcdmnaeyvnqanfvlnqlein
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.74 Rfree 0.221
    Matthews' coefficent 2.47 Rfactor 0.198
    Waters 361 Solvent Content 50.29

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 2
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 1g60
    1. Statistical analysis and prediction of proteinprotein interfaces
    AJ Bordner, R Abagyan - Proteins: Structure, Function, and , 2005 - Wiley Online Library
     
    2. SAM (dependent) I AM: the S-adenosylmethionine-dependent methyltransferase fold
    JL Martin, FM McMillan - Current opinion in structural biology, 2002 - Elsevier
     
    3. Understanding the evolution of restriction-modification sys-tems: Clues from sequence and structure comparisons.
    JM Bujnicki_ - 2001 - Citeseer
     
    4. Sequence_specific Methyltransferase_Induced Labeling of DNA (SMILing DNA)
    G Pljevalj_i_, F Schmidt, E Weinhold - ChemBioChem, 2004 - Wiley Online Library
     
    5. Cation interaction: to stack or to spread
    BK Mishra, VK Bajpai, V Ramanathan, SR Gadre - Molecular , 2008 - Taylor & Francis
     
    6. FASSM: enhanced function association in whole genome analysis using sequence and structural motifs
    K Gaurav, N Gupta, R Sowdhamini - In silico biology, 2005 - IOS Press
     
    7. Patch prediction of protein interaction sites: validation of a scoring function for an online server
    S Jones, Y Mukarami - Bioinformatics Research and Development, 2007 - Springer
     
    8. 1 Protein methyltransferases: Their distribution among the five structural classes of adomet-dependent methyltransferases
    HL Schubert, RM Blumenthal, X Cheng - The Enzymes, 2006 - Elsevier
     
    9. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    10. DNA Interaction of the CcrM DNA Methyltransferase: A Mutational and Modeling Study
    RF Albu, M Zacharias, TP Jurkowski - ChemBioChem, 2012 - Wiley Online Library
     
    11. Structural Insights into the Assembly and Shape of Type III Restriction-Modification (RM) EcoP15I complex by Small Angle X-ray Scattering
    YK Gupta, L Yang, SH Chan, JC Samuelson - Journal of Molecular , 2012 - Elsevier
     
    12. Subunit Interface Dynamics in Hexadecameric Rubisco
    M van Lun, D van der Spoel, I Andersson - Journal of Molecular Biology, 2011 - Elsevier
     
    13. Characterization, Classification and Alignment of Protein-Protein Interfaces
    H Zhu - 2010 - deposit.ddb.de
     
    14. Reprsentation simplifie des protines
    A Annexe - theses.ulb.ac.be
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch