.
The Open Protein Structure Annotation Network
PDB Keyword
.

1eg2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of RsrI methyltransferase, a member of the N6-adenine beta class of DNA methyltransferases. Nucleic Acids Res. 28 3950-3961 2000
    Site MCSG
    PDB Id 1eg2 Target Id APC116
    Molecular Characteristics
    Source Rhodobacter sphaeroides
    Alias Ids TPS4450,P14751, 1063 Molecular Weight 35653.29 Da.
    Residues 319 Isoelectric Point 6.56
    Sequence manrshhnaghramnalrksgqkhssesqlgsseigttrhvydvcdcldtlaklpddsvqliicdppyn imladwddhmdyigwakrwlaeaervlsptgsiaifgglqyqgeagsgdlisiishmrqnskmllanli iwnypngmsaqrffanrheeiawfaktkkyffdldavrepydeetkaaymkdkrlnpesvekgrnptnv wrmsrlngnslervghptqkpaavierlvralshpgstvldffagsgvtarvaiqegrnsictdaapvf keyyqkqltflqddglidkarsyeivegaanfgaalqrgdvas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.25
    Matthews' coefficent 2.16 Rfactor 0.214
    Waters 227 Solvent Content 43.06

    Ligand Information
    Ligands MTA (5'-DEOXY-5'-METHYLTHIOADENOSINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1eg2
    1. SAM (dependent) I AM: the S-adenosylmethionine-dependent methyltransferase fold
    JL Martin, FM McMillan - Current opinion in structural biology, 2002 - Elsevier
     
    2. Understanding the evolution of restriction-modification sys-tems: Clues from sequence and structure comparisons.
    JM Bujnicki_ - 2001 - Citeseer
     
    3. Structure of RsrI methyltransferase, a member of the N6-adenine _ class of DNA methyltransferases
    RD Scavetta, CB Thomas, MA Walsh - Nucleic acids , 2000 - Oxford Univ Press
     
    4. Sequence permutations in the molecular evolution of DNA methyltransferases
    J Bujnicki - BMC evolutionary biology, 2002 - biomedcentral.com
     
    5. Sequence_specific Methyltransferase_Induced Labeling of DNA (SMILing DNA)
    G Pljevalj_i_, F Schmidt, E Weinhold - ChemBioChem, 2004 - Wiley Online Library
     
    6. Structure prediction and phylogenetic analysis of a functionally diverse family of proteins homologous to the MT-A70 subunit of the human mRNA: m6A
    JM Bujnicki, M Feder, M Radlinska - Journal of molecular , 2002 - Springer
     
    7. Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase
    CB Thomas, RD Scavetta, RI Gumport - Journal of Biological , 2003 - ASBMB
     
    8. Rank information: A structure_independent measure of evolutionary trace quality that improves identification of protein functional sites
    H Yao, I Mihalek, O Lichtarge - Proteins: Structure, Function, , 2006 - Wiley Online Library
     
    9. Sequence and structure continuity of evolutionary importance improves protein functional site discovery and annotation
    AD Wilkins, R Lua, S Erdin, RM Ward - Protein , 2010 - Wiley Online Library
     
    10. FASSM: enhanced function association in whole genome analysis using sequence and structural motifs
    K Gaurav, N Gupta, R Sowdhamini - In silico biology, 2005 - IOS Press
     
    11. Crystal structure of a putative DNA methylase TTHA0409 from Thermus thermophilus HB8
    R Morita, H Ishikawa, N Nakagawa - Proteins: Structure, , 2008 - Wiley Online Library
     
    12. 1 Protein methyltransferases: Their distribution among the five structural classes of adomet-dependent methyltransferases
    HL Schubert, RM Blumenthal, X Cheng - The Enzymes, 2006 - Elsevier
     
    13. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    14. CARCINOGEN DETOXIFICATION COMPOSITION AND METHOD
    YMA Chen - US Patent App. 12/195,238, 2008 - Google Patents
     
    15. Carcinogen detoxification composition and method
    YMA Chen - US Patent App. 11/193,205, 2005 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch