The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative Sel1 repeat protein (KPN_04481) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 3rjv Target Id 390073
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS7668,YP_001338103.1, 91428 Molecular Weight 22932.08 Da.
    Residues 211 Isoelectric Point 4.78
    Sequence atepgsqyqqqaeagdrraqyyladtwvssgdyqkaeywaqkaaaqgdgdalallaqlkirnpqqadyp qarqlaekaveagsksgeivlarvlvnrqagatdvahaitllqdaardsesdaavdaqmllgliyasgv hgpeddvkaseyfkgssslsrtgyaeywagmmfqqgekgfiepnkqkalhwlnvsclegfdtgceefdr iskg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.1936
    Matthews' coefficent 3.45 Rfactor 0.1706
    Waters 178 Solvent Content 64.36

    Ligand Information


    Google Scholar output for 3rjv

    Protein Summary

    A TPR motif containg protein (6 repeats) with unknown function, a member of COG0790 (Sel1 subfamily). TPR proteins are often involved in protein-protein interactions. This protein is highly conserved in E. coli as YjcO.


    Fig. 1. TPR containing protein


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    148.01 kB22:48, 11 Apr 2011qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch