.
The Open Protein Structure Annotation Network
PDB Keyword
.

3pl2

    Title Crystal structure of a 5-keto-2-deoxygluconokinase (NCgl0155, Cgl0158) from Corynebacterium glutamicum ATCC 13032 KITASATO at 1.89 A resolution. To be published
    Site JCSG
    PDB Id 3pl2 Target Id 375206
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS6839,NP_599410.1, 3.40.1190.20, 285320 Molecular Weight 34745.17 Da.
    Residues 318 Isoelectric Point 4.69
    Sequence mtnltsthevlaigrlgvdiyplqsgvgladvqsfgkylggsaanvsvaaarhghnsallsrvgndpfg eyllaelerlgvdnqyvatdqtfktpvtfceifppddfplyfyrepkapdlniesadvslddvreadil wftltgfseepsrgthreilttranrrhtifdldyrpmfwespeeatkqaewalqhstvavgnkeecei avgeteperagrallergvelaivkqgpkgvmamtkdetvevppffvdvinglgagdafggalchglls ewplekvlrfantagalvasrlecstampttdeveaslnqkv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.89 Rfree 0.2252
    Matthews' coefficent 2.07 Rfactor 0.1805
    Waters 577 Solvent Content 40.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3pl2

    Protein Summary


    Ligand Summary

    The protein NP_599410.1 is annotated as sugar kinases, ribokinase family. NP_599410.1 belongs to PFAM PF00294 PfkB. This consists of carbohydrate and pyrimidine kinases.

    The monomer structure and biological dimer are shown below.

    RK10655A.png RK10655A_dimer.png

     

    There are many similar structures already available in PDB (see DALI table below). This structure was solved by Molecular Replacement method using the JCSG structure 2qcv as a search template.

     

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 2qcv 42.3 1.6 303 325 27 Putative 5-dehydro-2-deoxygluconokinase
    2 2var 41.7 1.7 303 311 24 Fructokinase
    3 2v78 41.6 1.8 303 311 24 Fructokinase
    4 2dcn 41.2 1.8 301 308 25 Hypothetical Fructokinase
    5 1wye 41.0 1.8 301 309 25 2-keto-3-deoxygluconate Kinase
    6 1v1a 38.7 2.0 296 301 28 2-keto-3-deoxygluconate Kinase
    7 1v1b 38.3 2.0 295 300 27 2-keto-3-deoxygluconate Kinase
    8 3iq0 38.1 2.3 303 308 22 Putative Ribokinase Ii
    9 1v19 38.1 2.1 296 301 28 2-keto-3-deoxygluconate Kinase
    10 3k9e 37.9 2.4 306 311 22 Putative Ribokinase Ii

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     RK10655A.png
    No description
    146.29 kB21:03, 29 Oct 2010abhinavkActions
     RK10655A_dimer.png
    No description
    249.54 kB21:03, 29 Oct 2010abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch