.
The Open Protein Structure Annotation Network
PDB Keyword
.

3msq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative ubiquinone biosynthesis protein (Npun02000094) from Nostoc punctiforme PCC 73102 at 2.85 A resolution. To be published
    Site JCSG
    PDB Id 3msq Target Id 359702
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS2772,23130561, 291294 Molecular Weight 25331.83 Da.
    Residues 223 Isoelectric Point 5.22
    Sequence menvitynndkgllayiqflassaqkigdgntdrvfdfedaldqtqmaqlavdelkkipevnalfserw lpapfnlddlaklpegtlghvyaremkargfdpyfykkvpvvddisylkmlwrsthdiyhvvagfdtnv fgeiglqafflaqtpipisvmllsfgmvmislyqptnfkalmteisrgyrvgshtpgkliaqkwdqlwd vqvseirerlgvnsil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.85 Rfree 0.223
    Matthews' coefficent 3.05 Rfactor 0.195
    Waters Solvent Content 59.65

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3msq

    Protein Summary

    This is the structure of CoQ4 of CoQ biosynthesis complex. Homologs are present in both bacteria and eukaroytes. This structure shares 20% seq identity with human coq4. It belongs to PFAM coq4 family of PFam (PF05019).

    The overall structure has some resemblance to hemoglobin/myglobin. Dali identifies that the structure is very similar to recent structure NsR141 by NESG (3kb4, 26% seq id, rmsd 1.9), NsR141 was complexed with geranylgeranyl monophosphate.

     

    Sequence analysis suggest that the protein may contain a possible metal binding site (around H129).

     

    Fig 1. Crystal structure of CoQ4

    cl6138c.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     cl6138c.png
    CL6138C
    135.25 kB22:36, 22 Mar 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch